(data stored in ACNUC7421 zone)

EMBL: CP001349.PE396

CP001349.PE396       Location/Qualifiers
FT   CDS_pept        453352..455529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0406"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; peptidase C39 bacteriocin processing;
FT                   SMART: AAA ATPase; KEGG: met:M446_0092 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55448"
FT                   /db_xref="GOA:B8IB55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022514"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB55"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55448.1"
FT                   /translation="MRLAGLLRSLGARASVKATPTVLQMEAVECGAAALAMVLAHHGAW
FT                   VPLEQLRIACGVSRDGSKASNIVKAARRFGLAAKGFRKEPATLHELPMPCILHWNFNHF
FT                   VVLEGIRGDHAFINDPAMGRRRITMTELDLAFTGVALAMEPTDEFRRLGRKPQGLLLLL
FT                   RELRFSRAAVGLVVGVSLALIVPGILIPGFTKVFVDEVLIQNSKGWLVPLLIGMGLTAL
FT                   FRAGVTALQLSLTLRLQTKLAVVMTSRFLWHVLALPMEFFAQRHAGDIANRVATNEEIA
FT                   RLLSGGVVSNALSLTSLVFFAAAMAVYDGLLAAIGVTLSLLNVLALRLIAGRREDLSRS
FT                   LALERGKLLGSTISAVRTIETLKASGLEDEAFAQWAGIQAKALNAEQELGAASTLLEAV
FT                   PTLISGLTLAAILGIGGLRVIEGSLTLGGLVAFQSLMASFSEPITALVNQIGSIQTIKG
FT                   GLERLEDVYNYPVDHPAPEPESEPLPPKLVGRVELRDVSFGYAILEPPLLADLSITIEP
FT                   GTRLALVGLSGSGKSTLGRLICGLLKPWSGEVRIDGRRLDAIPPEVFANSVAYVDQDVV
FT                   LFEGTARDNLTLWDPTVAEPDLSLALKDAAIHGEIATRPGNYDCRVVEGGTNFSGGQRQ
FT                   RIEIARALVANPSVIVLDEATAALDPVTEKAIDDNLRRRGCTCIIIAHRLSTIRDCDEI
FT                   IVLEQGRIVERGTHEQLIARAGAYAHLVAQQ"
     atgcgcctcg ccggcctcct ccgcagcctc ggcgcccggg cgtccgtcaa ggcgaccccg        60
     accgtgctgc agatggaggc cgtcgagtgt ggagcggcgg ccctcgccat ggtcctcgcc       120
     catcacgggg cctgggtgcc gctcgaacag ctgcggatcg cctgcggggt ctcccgcgac       180
     ggcagcaagg ccagcaacat cgtcaaggcg gcgcggcgct tcggcctcgc cgccaagggt       240
     tttcgcaaag agcccgcgac cctgcacgag ctgccgatgc cgtgcatcct gcattggaac       300
     ttcaaccact tcgtggtcct cgaaggcatc cggggggatc acgccttcat caacgacccg       360
     gccatgggcc gccgccgcat caccatgacg gagctcgacc tcgccttcac gggcgtcgcc       420
     ctggcgatgg agccgacgga cgagttccgc aggctcggac gcaagccgca gggcctgctg       480
     ctgctgctgc gggagctgcg cttctcgcgc gcagccgtcg gcctcgtggt cggcgtgagc       540
     cttgcgctga tcgttcctgg catcctcatc ccgggcttca ccaaggtctt cgtcgacgag       600
     gtgctgatcc agaactcgaa gggctggctc gtgccgctcc tcatcggcat ggggctcacc       660
     gccctgttcc gggccggcgt gacggcgctg cagctctcgc tgaccctgcg gctgcagacc       720
     aagctcgcgg tggtgatgac gagccgattc ctgtggcacg tcctggcact gccgatggag       780
     ttcttcgccc agcgccacgc gggcgacatc gccaaccggg tcgccaccaa cgaagagatc       840
     gcccgcctgc tctcgggcgg cgtggtgagc aacgcgctca gcctcacctc gctggtgttc       900
     ttcgccgccg ccatggcggt ctacgacggg ctgcttgccg cgatcggcgt gaccctctcg       960
     ctcctcaacg tcctggcgct gcggctgatc gcggggcgcc gagaggatct gagccgcagc      1020
     ctcgccctcg aacgcggcaa gctcctcggc agcacgatca gcgcggtgcg caccatcgag      1080
     accctcaagg cgagcggcct ggaggacgag gccttcgccc agtgggcggg gatccaggcc      1140
     aaggccctca acgccgagca ggaactcggc gcggcctcga ccctgctcga ggcggtcccg      1200
     accctcatct ccgggctgac cctcgcggcg atcctcggca tcggcggcct gagggtgatc      1260
     gagggctcgt tgaccctcgg cggcctcgtg gccttccagt ccctgatggc gagcttctcc      1320
     gagccgatca ccgcgctcgt caaccagatc ggcagcatcc agaccatcaa gggcggtctg      1380
     gagcggctgg aggacgtcta caactatccg gtggaccacc cggcaccgga gccggaatcc      1440
     gagccgctgc cgcccaagct cgtcggccgc gtggagctgc gggacgtctc cttcggctac      1500
     gcgatcctgg agccgccgct gcttgcggat ctctcgatca ccatcgagcc cggcacccgg      1560
     cttgccctgg tcggcctgtc gggcagcggg aaatccaccc tcgggcgcct gatctgcggc      1620
     ctgctcaagc cctggtcggg cgaggtgcgg atcgacggcc gccggctcga tgccatcccg      1680
     ccggaggtct tcgcgaattc ggtggcctat gtcgaccagg acgtcgtcct gttcgagggc      1740
     acggcgcggg acaatctcac cctgtgggat cccaccgtgg cggagcccga cctgtccctc      1800
     gccctcaagg acgcggcgat ccacggggag atcgcgacgc ggccgggcaa ctacgattgc      1860
     cgggtggtgg agggcggcac caatttcagc ggcggccagc gtcagcgcat cgagatcgcc      1920
     cgtgccctcg tcgcgaaccc gtcggtgatc gtgctcgacg aggcgaccgc cgccctcgac      1980
     ccggtgaccg agaaggccat cgacgacaac ctgcggcggc ggggctgcac ctgcatcatc      2040
     atcgcccacc gcctgagcac gatccgggat tgcgacgaga tcatcgtgct ggagcagggc      2100
     cggatcgtcg agcgggggac gcacgagcag ctcatcgccc gcgcgggcgc ctacgcccat      2160
     ctggtggccc agcaatga                                                    2178
//

If you have problems or comments...

PBIL Back to PBIL home page