(data stored in ACNUC7421 zone)

EMBL: CP001349.PE397

CP001349.PE397       Location/Qualifiers
FT   CDS_pept        455526..458420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0407"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_0091 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55449"
FT                   /db_xref="GOA:B8IB56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022515"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB56"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55449.1"
FT                   /translation="MTEARTRQPGGLALVEEALPPPQVILDGRHPVRLGRADRLLQVVL
FT                   GHADLFAVRHAAGGVAGPRRHLLRIESGGLIPPIPEAAGEGGERLEIIAVGTPGTEARI
FT                   VAREAWARRDLVEAWIARLAGVIAGSHPSWDIREAEGGAEALEPGERRRGPARALRWVA
FT                   VEAGTGRLLGREPALGPGGLPLPLAAGLWIEAGPDGCRLAASAGPEDDRLWEALDCFHH
FT                   CAVAALHEAATGEEAREAQRLARRSELDAVRSAELFGRLSGIVARRPEQSRPSVDPDDP
FT                   LLSACTILAETIPAPIVRPPGRRRTAQDFVAVVEIARASRLRVRRTLLRGTWWREDVGP
FT                   LLGWHGEAGDPVALVRDRRGYVMTNPAAGTRRRVDAALAAELAVEAASFYPTLPARALT
FT                   LRDLLAFALRRARGTIAGIVLPAVVLGLLALVSPLITQALVNSAIPRSELDQLTVCAIA
FT                   LAVTAIAAAAVQALEGLAVLRLEGLIDWTLQAAMIDRLLRLRAGLFRDYTVGDLVDRAM
FT                   GIDAVRRLLTGRTLRSLLAGVFCWFSIGLMLVYDVTLALIAVALALLRGLLILAASALR
FT                   LYHESRHFDGQGRVAGFVLQLFAGIGKLRVAHAGVRALAVWSQLFATQKGHFLAAQRIG
FT                   NGLAVVETAFPTFATLAIFAAASALGSTLTQNLGAFLAFFAAFGQTMAGIGLWASGISE
FT                   ALVAIPHVTRMRPLVAAEAEIADDRKPPGELAGAIELSRVTFRYAPFGPPVLDTVSLRI
FT                   APGEYVAIVGPSGSGKSSLFRLLLGFETPESGAVFYDGKALDTLDVSALRRQLGVVLQN
FT                   GRLATGSLYENICGGVPLPLDQAWEAARLAGLEADIRAMPMGLQTVVAEGVNTLSGGQR
FT                   QRVLIARAIARRPRILLLDEATSALDNRSQAVVSASLGALNVTRLVIAHRLSTVREADR
FT                   IVVLAEGRIVQTGTFDELIAAPGLFAEFAQRQLL"
     atgaccgagg cgcggacgcg gcagccgggc gggctcgccc tggtggagga ggcgctgccc        60
     cccccgcagg tcatcctcga tggccggcat ccggtgcggc tcggccgcgc ggacaggctg       120
     ctgcaggtcg tcttaggcca tgccgacctc ttcgccgtcc ggcacgcggc agggggcgtg       180
     gccggcccgc gccgtcacct cctgcggatc gagagcggcg gcctcatccc gcctatcccc       240
     gaggcggccg gagagggggg cgagcgcctc gaaatcatcg ccgtgggcac gcccggcacc       300
     gaggctcgca tcgtcgcgcg cgaagcctgg gcgcgccggg acctcgtcga ggcctggatc       360
     gcgcgtcttg ccggcgtgat cgccgggtcg catccgagct gggacatccg cgaggcggaa       420
     ggcggggccg aggcgctgga gccaggcgag cggcggcgcg ggccggcccg cgcgctgcgc       480
     tgggtcgcgg tcgaggccgg aaccgggcgc ctcctcggtc gcgagccggc cctcggtccc       540
     ggcggcctgc ccctgcccct cgccgcgggc ctgtggatcg aggccggccc cgacggatgc       600
     cgccttgccg cgagcgcagg cccggaggat gaccggctct gggaggcgct cgactgcttc       660
     caccattgcg cggtcgccgc cctgcacgag gccgcaacgg gcgaggaggc ccgcgaggcg       720
     caacgcctcg cccgccggtc cgagctcgac gcggtgcgct cggccgagct gttcgggcgc       780
     ttgagcggaa tcgtggcgcg ccgccccgag caaagccgcc cctccgtcga tccggacgat       840
     ccgcttctgt ccgcctgcac catcctggcc gagacgatcc ccgctccgat cgtgcgcccg       900
     cccggccgcc gcaggactgc gcaggacttc gtcgccgtgg tcgagatcgc ccgcgcgtcg       960
     cggctgcgcg tgcgccgcac cctgctgcgt ggcacgtggt ggcgcgagga tgtcgggccg      1020
     ctgctcggat ggcacggcga ggcaggcgat ccggtggcgc tggtccgcga ccgccggggc      1080
     tacgtgatga cgaatccggc cgcggggacg cggcggcgcg tcgatgcggc cctcgctgcg      1140
     gaactcgccg tcgaggcggc gagcttctat ccgaccctgc ccgcccgggc cctcaccctg      1200
     cgcgacctcc tcgccttcgc gctgcggcgc gcgcgcggca ccatcgcggg catcgtcctg      1260
     ccggccgtgg tgctgggcct cctcgccctc gtctcgccgc tcatcaccca ggctctcgtc      1320
     aattccgcca ttccccgcag cgagctcgac cagctcacgg tctgcgccat cgcgctcgcc      1380
     gtgacggcga tcgccgccgc cgccgtgcag gcgctggagg ggctcgccgt gctgcgcctc      1440
     gaaggcctga tcgactggac gctccaggcc gccatgatcg accgcctgct gcggctgcgc      1500
     gccgggcttt ttcgcgacta cacggtcggc gacctcgtcg accgggcgat ggggatcgac      1560
     gcggtgcggc gcctgctcac ggggcggacc ctgcgcagcc tgctcgcggg cgtcttctgc      1620
     tggttcagca tcgggctgat gctggtctac gacgtgacgc tcgcgctcat cgcggtggcg      1680
     ctcgccctcc tgcggggcct cctcatcctg gcggcgagtg cgctgcgcct ctatcacgag      1740
     agccggcatt tcgacggcca gggccgggtg gcgggcttcg tgctccagct ctttgcaggg      1800
     atcggcaagc tgcgggtcgc gcatgcgggc gtccgggcgc tcgcggtctg gtcgcagctc      1860
     ttcgccacgc agaagggtca cttcctggcc gcccagcgga tcggcaacgg gctcgccgtc      1920
     gtcgagaccg ccttcccgac cttcgccacc ctggcgatct tcgccgcagc ctcggcgctg      1980
     ggcagcacgc tgacgcagaa tctcggcgcc ttcctcgcct tcttcgccgc cttcggccag      2040
     accatggcgg ggatcggcct gtgggcctcg gggatcagcg aggccctggt ggcgatcccg      2100
     cacgtcaccc gcatgcgccc gctcgtcgcc gcggaggcgg agatcgcgga cgaccgcaag      2160
     ccgccggggg agctggcggg cgcgatcgag ctctcgcgcg tcaccttccg gtacgccccc      2220
     ttcgggccgc ccgtcctcga caccgtctcc ttgcgcatcg cgcccggcga atacgtggcg      2280
     atcgtggggc cctcggggag cggcaagtcc tcgctgttcc gcctgctcct cggcttcgag      2340
     acgccggaat ccggcgcggt cttctatgac gggaaggcgc tcgacaccct cgacgtcagc      2400
     gcattgcgcc gccagctcgg ggtcgtgctg cagaacgggc ggctcgccac cggcagcctg      2460
     tacgagaaca tctgcggggg tgtccccctg ccgctggatc aggcctggga ggccgcccgg      2520
     ctggcggggc tcgaagccga catccgggcg atgccgatgg gcctgcagac cgtcgtggcc      2580
     gagggggtga acaccctgtc gggaggccag cggcagcgcg tgctgatcgc gcgcgcaatc      2640
     gcccgccggc cccggatcct gctgctcgac gaggcgacga gcgccctcga caaccggtcg      2700
     caggcggtgg tgagcgcgtc cctcggggcc ctcaacgtga cccgcctcgt catcgcgcac      2760
     cggctgagca ccgtgcggga ggccgaccgc atcgtcgtgc tcgccgaggg gcgcatcgtc      2820
     cagaccggca cgttcgacga actcatcgcg gcgcccggcc tgttcgccga gttcgcgcag      2880
     cggcagctct tgtag                                                       2895
//

If you have problems or comments...

PBIL Back to PBIL home page