(data stored in ACNUC7421 zone)

EMBL: CP001349.PE398

CP001349.PE398       Location/Qualifiers
FT   CDS_pept        complement(458853..460022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0408"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: met:M446_6098 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55450"
FT                   /db_xref="GOA:B8IB57"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB57"
FT                   /inference="protein motif:TFAM:TIGR00016"
FT                   /protein_id="ACL55450.1"
FT                   /translation="MSDAILAINAGSSSLKFALYAAGSLALLCRGGVSGLGGPVAVEAS
FT                   GPVPLATGAPPPAGSNHATAIAWLLDAVRRMPDLVLRAAGHRVVHGGRDYAAPVLIDGA
FT                   VLDALERLVPLAPAHQPHNLAAIRAVAAAWPNLPQVACFDTAFHRTQPRLAQLFPIPRA
FT                   LTDAGILRYGFHGLSYQHVAETLPEVAGERAEGRVIVAHLGHGASLCAMRARRSIASTM
FT                   GFTALDGLMMGTRSGAVDPGLVLHLIRERGLDPAAVADLLNNRSGLLGVSELSDDVRVL
FT                   QESGDPRAAEALDLFAYRAVREAGSLMAALGGLDLIVFTAGIGEHAPRVRAAIAAGLSF
FT                   AGVELDEERNAAGRGRISRDGSPVAVYVVPANEELPIARAAARLVLGAG"
     atgagcgatg cgatcctggc gatcaatgcg ggctcgtcga gcctgaaatt cgccctctac        60
     gcggccggct cgctggcgct gctgtgccgg ggcggcgtct ccggtctcgg cggcccggtc       120
     gccgtggagg cgtcgggtcc ggtgccgctc gcgaccgggg ccccaccgcc ggcgggcagc       180
     aaccacgcga ccgccatcgc gtggctcctc gatgcggtcc ggcgcatgcc ggacctcgtc       240
     ctgcgggcgg cgggacaccg ggtcgtgcat ggcgggcggg actacgccgc ccccgtcctg       300
     atcgacggcg cggtcctcga tgcgctcgag cggctcgtgc ccctcgcccc ggcgcatcag       360
     ccccacaacc tcgcggccat ccgggcggtg gcggcggcct ggccgaacct gccgcaggtc       420
     gcctgcttcg acacggcctt ccaccgcacg cagccgcggt tggcgcagct cttcccgatc       480
     ccgcgggcgc tcaccgacgc gggcatcctc cgctacggct tccatggact ctcctaccag       540
     catgtcgccg agacgctgcc ggaggtcgcg ggcgagcggg cggagggccg cgtgatcgtg       600
     gcccatctcg ggcacggggc cagcctctgc gccatgcggg cgcggcggag catcgcctcc       660
     acgatgggct tcacggccct cgacgggctg atgatgggca cccgctccgg tgccgtcgat       720
     ccggggctgg tgcttcacct catccgcgag cgcggcctgg atccggccgc ggtggccgac       780
     ctcctcaaca accgctccgg cctcctcggc gtctccgaac tcagcgacga cgtgcgggtg       840
     ctccaggaat ccggcgaccc gcgggccgcg gaagcgctcg acctcttcgc ctaccgggcg       900
     gtgcgcgagg ccggctctct catggcggcg ctcggcggcc tcgacctcat cgttttcacg       960
     gccggcatcg gcgagcacgc gccgcgggtc cgggccgcga tcgccgccgg cctgtccttc      1020
     gcgggggtgg agctcgacga ggagcgcaac gcggccgggc gaggccgcat cagccgcgac      1080
     ggatccccgg tggcagtcta tgtcgtgccg gcgaacgagg aactgccgat cgcgcgggcc      1140
     gccgcgcggc tggtcctggg cgccggttag                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page