(data stored in ACNUC7421 zone)

EMBL: CP001349.PE399

CP001349.PE399       Location/Qualifiers
FT   CDS_pept        complement(460019..461461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0409"
FT                   /product="MaoC domain protein dehydratase"
FT                   /EC_number="2.3.1.19"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; MaoC
FT                   domain protein dehydratase; KEGG: met:M446_6099 phosphate
FT                   butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55451"
FT                   /db_xref="GOA:B8IB58"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB58"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACL55451.1"
FT                   /translation="MEPLQYIENRTLAEIRVGDTASLTRTLKPQDISLFAVVSGEVNPA
FT                   HLDKDYAEADRFHGVIAHGLWGGSLISAVLGTELPGPGTIYLGQSLRFLRPVRVGDAIT
FT                   ARVTVREKDAARARLILDCTCLNAQGEAVITGEAEVLAPTEKVRRPRVLLPEVHLHERG
FT                   AQWRRLIAAAQGLAPIRTAVVHPCDAVSLRGALAGAQAGLIAPVLVGPRGKIAAAAEAA
FT                   GLSLDGLEIVDAPHSHAAAERAVALARAGTVAALMKGALHTDEILAAAVRKETGLRTER
FT                   RMSHVYALDVPHYPKPLFITDAAVNIAPTLEEKRDIVQNAIDLCRALGLAQPKAAILSA
FT                   VETVSMKLGSTLDAAALCKMAERGQITGGIVDGPLAFDNAVSREAAATKGLASAVAGDA
FT                   DILVAPDLVSGNMLAKQLIHLAGADAAGLILGARVPIILTSRSDSAEVREASCALAQLF
FT                   VHRAGAAAAPAGAAAGPVGAAV"
     atggaacccc tccagtacat cgagaaccgc accctggcgg agatccgggt cggcgacacg        60
     gcgagcctca cccggacgct gaagccgcag gacatcagcc tgttcgcggt cgtctccggc       120
     gaggtgaacc cggcccatct cgacaaggac tacgccgagg ccgatcgctt ccatggcgtc       180
     atcgcgcatg ggctgtgggg cggctcgctg atctcggccg tgctcggcac cgagctgccg       240
     gggccgggca cgatctatct cggccagtcg ctgcgcttcc tgcggccggt gcgggtcggc       300
     gacgccatca cggcgcgcgt caccgtgcgc gagaaggatg cggcccgcgc gcggctcatc       360
     ctcgactgca cctgcctcaa cgcgcagggc gaggcggtca tcaccggcga ggccgaggtg       420
     ctcgccccga ccgagaaggt gcgccgcccc cgcgtcctcc tgccggaggt ccacctgcac       480
     gagcggggcg cgcagtggcg gcgcctgatc gcggcggcgc aggggctcgc cccgatccgc       540
     acggccgtgg tgcatccatg cgatgcggtc tcgctccggg gcgctctcgc gggggcccaa       600
     gctggcctca tcgctccggt gctggtcggg ccgcggggca agatcgcggc ggcggccgag       660
     gctgccggcc tctccctcga cgggctggag atcgtcgatg caccccacag ccacgccgcc       720
     gcagagcggg cggtggcgct ggcccgggcc ggaaccgtgg cggccctgat gaagggggcg       780
     ctccataccg acgagatcct ggcagcggcc gtgcgcaagg agacgggcct gcgcaccgag       840
     cggcgcatga gccacgtcta cgccctcgac gtgccgcact accccaagcc gctcttcatc       900
     acggatgcgg cggtcaacat cgcgccgacg ctcgaagaga agcgcgacat cgtgcagaac       960
     gccatcgatc tgtgccgggc gctcggcctc gcgcagccga aggcggcgat cctctcggcg      1020
     gtggagacgg tgtcgatgaa gctcggctcc accctcgatg cggcggcgct ctgcaagatg      1080
     gccgagcgcg gccagatcac cggcgggatc gtcgacgggc cgctcgcctt cgacaacgcc      1140
     gtctcgcggg aggccgccgc cacgaagggg ctcgcctcgg cggtggcggg ggatgccgac      1200
     atcctggtgg cgcccgatct cgtctccggc aacatgctgg ccaagcagtt gatccatctc      1260
     gcgggggcgg atgcggccgg gttgatcctc ggggcgcggg tgccgatcat cctgacgagc      1320
     cgatccgaca gtgccgaggt gcgcgaggcc tcctgtgcgc tcgcccagct cttcgtgcac      1380
     cgggccggtg ccgccgcggc gccggcagga gccgccgcgg gtcccgtagg agccgccgta      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page