(data stored in ACNUC7421 zone)

EMBL: CP001349.PE4

CP001349.PE4         Location/Qualifiers
FT   CDS_pept        4708..6558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0005"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: met:M446_0004 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55056"
FT                   /db_xref="GOA:B8ISZ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ4"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ACL55056.1"
FT                   /translation="MTSRLDEARAALRTTFGYEDFRPGQAEVIGAVLAGRDVLAVMPTG
FT                   SGKSMTYQLPALVERSLTVVVSPLIALMHDQVQQMQGFGVAAATLNSTIDEATARAAWR
FT                   QIRAGDLRLLFVSPERLLMEGLIEALQSAGVRRLAVDEAHCVSQWGHDFRPEYRDLARA
FT                   REALGGVQTVALTATADTATRADISERLFPAGRKPEVFVHSFDRPNIRLTFAPKEHPTR
FT                   QISRFLRPRRAESGIVYCSSRKRTEQLAQLLQEEGVRALPYHAGLDQGTRMRNQDAFLQ
FT                   EDGIVMVATVAFGMGINKPDVRFVCHADMPSNVEGYYQEIGRAGRDGLPADTLTLYGLD
FT                   DMALRRRQIDEKDIPDERRRVERRKLEAMIALCEGATCRRQSLLAYFGEASGPCGRCDL
FT                   CRGGVSLVDGTVAAQKVLSAIVRTGQRFGAAYICDLVHGKETDQIRRNGHTRLRTFGVG
FT                   ADKPVAAWRSIMRQLFAAGAVAENQDGYGGLAMTDKGEAILFGRETVQLRPDPEPRPPK
FT                   ERRSRSAADHDDTLGLSPDDEALFQHLRGLRATLARQEGVAAYMIFPDRTLIEMARAKP
FT                   VDLWALRSVHGVGERKREAYGEAFVGTIADFLADAAKRAG"
     atgacctcac gcctcgacga ggcccgcgcc gcgcttcgca ccaccttcgg ctatgaggat        60
     ttccggcccg gccaggccga ggtcatcggc gccgtgctcg ccgggcgcga cgtcctcgcc       120
     gtgatgccga cgggctcggg caagtcgatg acctatcagc tcccggccct ggtcgagcgc       180
     tcgctcaccg tcgtggtctc gccgctgatc gccctgatgc acgaccaggt gcagcagatg       240
     caggggttcg gcgtcgccgc cgcgaccctc aactccacga tcgacgaggc cacggccagg       300
     gcggcctggc gccagatccg ggcgggcgac ctgcgcctgc tcttcgtctc gcccgagcgc       360
     ctgctgatgg aggggctgat cgaggcgctc cagagcgcgg gcgtgcggcg cctcgccgtc       420
     gacgaggcgc attgcgtctc gcaatggggc cacgacttcc ggcccgaata ccgcgatctc       480
     gcccgggccc gcgaggcgct gggcggcgtc cagacggtgg cgctcacggc gaccgccgac       540
     accgccaccc gggccgatat cagcgagcgg ctcttccccg ccggccgcaa gcccgaggtc       600
     ttcgtccatt ccttcgaccg gccgaacatc cggctgacct tcgcgcccaa ggagcacccg       660
     acgcgccaga tcagccgctt cctgcgcccg cgccgggcgg agagcggcat cgtctactgc       720
     tcgtcgcgca agcgcaccga gcagctcgcg cagctgctgc aggaggaggg cgtcagggcc       780
     ctgccctacc atgcgggcct cgaccagggc acccgcatgc gcaaccagga tgccttcctg       840
     caggaagacg ggatcgtcat ggtggcgacc gtcgccttcg gaatgggcat caacaagccc       900
     gacgtgcgct tcgtctgcca cgccgacatg ccctccaatg tcgagggcta ttaccaggag       960
     atcggccgcg ccgggcgcga cgggctgccg gccgacacgc tgaccctcta cggcctcgac      1020
     gacatggcgc tgcgccgccg gcagatcgac gagaaggaca tcccggacga gcgccgtcgg      1080
     gtcgagcgcc gcaagctcga ggcgatgatc gcgctctgcg agggggcgac ctgccgccgc      1140
     cagtcgctgc ttgcctattt cggcgaggcg agcggcccct gcggccgctg cgacctctgc      1200
     cggggcggcg tctccctggt cgacggcacg gttgcggccc agaaggtcct gtccgcgatc      1260
     gtgcgcaccg gccagcgctt cggcgcggcc tatatctgcg acctcgtcca tggcaaggag      1320
     accgaccaga tccgccgcaa cggccatacg cggctcagga ccttcggcgt cggggccgac      1380
     aagccggtgg cggcatggcg ctccattatg cgccagctct tcgcggcggg ggcggtcgcc      1440
     gagaaccagg acggctatgg cggcctcgcc atgaccgaca agggcgaggc gatcctgttc      1500
     ggccgcgaga cggtgcaact gcgtcccgat ccggagccgc gcccgcccaa ggagcgccgc      1560
     agccgcagcg ccgccgacca cgacgacacg ctcggcctgt cgccggacga cgaggcgctg      1620
     ttccagcacc tgcggggcct gcgcgccacg ctcgcgcgtc aggagggggt tgccgcctac      1680
     atgatcttcc cggaccgcac gctcatcgag atggcccgcg ccaagcccgt cgacctctgg      1740
     gccctgcgct ccgtgcacgg cgtcggcgag aggaagcgcg aggcctatgg cgaggccttc      1800
     gtcggcacca tcgcggattt cctcgccgat gcggccaagc gggccggctg a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page