(data stored in ACNUC7421 zone)

EMBL: CP001349.PE40

CP001349.PE40        Location/Qualifiers
FT   CDS_pept        44173..44775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0041"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   met:M446_0040 3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55092"
FT                   /db_xref="GOA:B8IT30"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT30"
FT                   /inference="protein motif:TFAM:TIGR00171"
FT                   /protein_id="ACL55092.1"
FT                   /translation="MEKFTVLEGVAAPLRIVNVDTDRIIPKQYLKTIERTGLGKGLFSE
FT                   MRYRDDGSENPDFVLNQPAYRNAKILVAGDNFGCGSSREHAPWALADFGIRCIISTSFA
FT                   DIFFNNSAKNGILLITVSPEDLEKLFDDAERGANATLTVDLERQEIRGPDGGVLHFEID
FT                   PARKHNLLNGLDEIGLTLERAPAIEAYEAKLAERPWA"
     atggaaaagt tcaccgttct cgaaggcgtc gcggcaccgc tgcggatcgt caacgtcgat        60
     accgatcgca tcatccccaa gcagtacctc aagaccatcg agcgcacggg actcggcaag       120
     ggcctcttct cggagatgcg ctaccgggac gacgggtcgg agaatccgga cttcgttctc       180
     aaccagcccg cttaccgcaa cgccaagatc ctggtggcgg gggataattt cggctgcggc       240
     tcgtcgcgcg agcatgcccc ctgggcgctc gcggatttcg gcatacgctg catcatctcg       300
     acgagcttcg ccgacatctt cttcaacaac agcgccaaga acggcatcct gctgatcacg       360
     gtatcgccgg aggatctgga gaagctgttc gacgacgccg agcggggcgc caacgcgacg       420
     ctgaccgtcg acctggagcg ccaggagatc cgcgggccgg atggcggcgt gctgcatttc       480
     gagatcgatc cggcccgcaa gcacaacctg ctcaacgggc tcgacgagat cggcctgacc       540
     ctggagcggg ccccggcgat cgaggcctac gaggcgaagc tcgccgagcg gccctgggcc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page