(data stored in ACNUC7421 zone)

EMBL: CP001349.PE401

CP001349.PE401       Location/Qualifiers
FT   CDS_pept        complement(461561..463441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0411"
FT                   /product="Poly-beta-hydroxybutyrate polymerase domain
FT                   protein"
FT                   /note="PFAM: alpha/beta hydrolase fold;
FT                   Poly-beta-hydroxybutyrate polymerase domain protein; KEGG:
FT                   met:M446_6101 poly-beta-hydroxybutyrate polymerase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55453"
FT                   /db_xref="GOA:B8IB60"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB60"
FT                   /inference="protein motif:PFAM:PF07167"
FT                   /protein_id="ACL55453.1"
FT                   /translation="MPATSIQMHPPDHVWPVQAATRPKPLAPTNDRRADPAPTNDRRAD
FT                   PALTDADRELLMTSEAIDLALHAAAARLTGGLSPAALANAWLDWGVHLAFSPGKQTELL
FT                   VKAARKSSRLSHFLLRTLMPPGRAEPCIAPLPQDHRFDDPAWQAWPFNLVYQSFLLNQQ
FT                   WWHNATTGVRGVSRAHENLVAFTARQMLDGVSPSNNPITNPVVLSETLRSGGANLVQGA
FT                   LNAMEDARRALAGSKPVGAEGFAVGREVAVTPGRVVYRNSLIELIQYAPTTQAVRPEPI
FT                   LIVPAWIMKYYILDLSPQNSLVRHLVGQGFSVFMISWRNPGPEDRNISFDDYRRLGIMA
FT                   ALDAIAAIVPDRPVHAAGYCLGGTLLSIAAAAMARDGDARLASLTLFAAQVDFTEAGEL
FT                   TLFINESEISFLESLMQSDGTLDAKQMAGAFQLLRSNDLIWSRMVNSYLLGRREAMTDL
FT                   MAWNADATRMPARMHAEYLRSLFHDNDLAEGRFAVGGRPVALTDIRAPVFAVGTERDHV
FT                   APWHSVFKLILLSDTEVTFLLASGGHNAGIVSEPGRPHRHFRVHTHRATDRYLDPETWL
FT                   QAARLEQGSWWPEWTAWLAARSGPPGPPPRMGASGSQDLGPAPGTYVREG"
     atgcccgcca cctccatcca gatgcatccc cccgatcacg tatggccggt ccaggccgcg        60
     acccggccga agccgctcgc gcccaccaat gaccgcaggg ccgatccggc gcccaccaat       120
     gaccgcaggg ctgatccggc gctcacggat gccgaccgcg aactcctgat gacgagcgag       180
     gccatcgacc tcgcccttca cgcggcggcg gcgcgcctca cgggcgggct ctcgccggcg       240
     gccctcgcca atgcctggct cgactggggc gtccacttgg ccttctcgcc gggcaagcag       300
     accgagctcc tggtcaaggc ggcccgcaag agcagccgcc tctcgcattt cctgctccgg       360
     accctgatgc cgccggggcg ggccgagccc tgcatcgcac cgctgcctca ggaccaccgc       420
     ttcgatgatc cggcctggca ggcatggccc ttcaacctcg tctaccagtc cttcctgctc       480
     aaccagcaat ggtggcacaa cgccaccacg ggcgtgcgcg gcgtgtcgcg ggcgcacgag       540
     aacctcgttg ccttcacggc gcgccagatg ctcgacggcg tctccccgtc gaacaatccg       600
     atcaccaacc cggtggtgct gagcgagacc ctgcgcagcg gcggcgccaa cctcgtgcag       660
     ggcgcactca acgccatgga ggatgcgcgg cgggcgctcg cgggatcgaa gcccgtcggc       720
     gccgagggct tcgcggtcgg acgcgaggtc gccgtcacgc cgggccgggt cgtctaccgc       780
     aacagcctga tcgagctgat ccagtacgcg ccgaccacac aggcggtccg gcccgagccg       840
     atcctgatcg tgccggcctg gatcatgaaa tactacatcc tcgatctctc gccgcagaac       900
     tcgctcgtcc gccacctcgt cgggcagggt ttttcggtgt tcatgatctc ctggcgcaat       960
     ccgggtccgg aggaccgaaa tatctcgttc gacgattacc ggcgcctcgg catcatggcg      1020
     gcgctcgacg cgatcgcggc gatcgttccg gaccggccgg tgcatgcagc gggctactgc      1080
     ctcggcggca cgctgctctc gatcgccgcc gccgccatgg cgcgcgacgg cgacgcgcgg      1140
     ctcgcctcgc tcaccctctt cgccgcgcag gtcgacttca ccgaggccgg cgaactcacc      1200
     ctgttcatca acgagagcga gatcagcttc ctcgagagcc tgatgcagag cgacgggacc      1260
     ctcgacgcga agcagatggc cggcgccttc cagctgctgc gctcgaacga cctgatctgg      1320
     tcgcgcatgg tgaacagcta tctcctcggc cggcgcgagg cgatgaccga cctgatggcc      1380
     tggaacgccg acgcgacccg gatgccggca cggatgcatg ccgagtacct gcgcagcctc      1440
     ttccacgaca acgatctcgc ggagggccgt ttcgcggtcg gcggccggcc ggtggcgctc      1500
     accgacatcc gtgcgccggt cttcgcggtc ggcaccgagc gcgaccacgt cgcgccctgg      1560
     cactcggtgt tcaagctcat cctgctttcc gataccgaag tgaccttcct gctcgcgagc      1620
     ggcggccaca atgccgggat cgtgtccgag cccggccgtc cccaccgcca tttccgcgtg      1680
     cacacgcatc gcgccaccga ccgctacctc gacccggaga cctggctgca ggccgcccgg      1740
     ctcgaacagg gatcctggtg gccggaatgg actgcgtggc tcgccgcgcg ctccgggccg      1800
     cctggccccc cgccgcggat gggggcgtct ggcagccagg atctgggccc ggcgcccggt      1860
     acctacgtgc gggagggcta a                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page