(data stored in ACNUC7421 zone)

EMBL: CP001349.PE403

CP001349.PE403       Location/Qualifiers
FT   CDS_pept        complement(464290..465012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0413"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: regulatory
FT                   protein Crp; KEGG: met:M446_5720 Crp/FNR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55455"
FT                   /db_xref="GOA:B8IB62"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB62"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACL55455.1"
FT                   /translation="MVACRVNSLPPPRNLLLASLSPEDWSAVAPRLERVTLRPRQILEE
FT                   PRTEIRAVYFIERGFAAVQVRTQADGTHGVGLVGRFGMTGLSLLLGTRRAPFRISVQVA
FT                   GEAFRLDAAEAAALFAENTALRRLGLAYIQAVMVQGAQLSLCNARHSMKHRVRRWLLLA
FT                   QDWLGEPEIAVSHQLIAGLLGVRRASVSEQIERLEQAGIVRQQRASITVLCREALEQDS
FT                   CECHALISAEYRRLFTRR"
     gtggttgcgt gccgagtgaa ctccttgcct cctccccgta atctcctgct ggcgtccttg        60
     agcccggagg actggtcggc ggtggcgccc cgcctggagc gcgtgacgct gcgccccagg       120
     cagatcctcg aagagccccg gaccgagatc cgcgccgtct acttcatcga gcggggcttc       180
     gcggccgtgc aggttcggac ccaggccgac ggcacccacg gcgtcggctt ggtcggacgt       240
     ttcggcatga cggggttgtc cctgctgctg ggcacccgcc gggcgccgtt ccgcatcagc       300
     gtccaggtcg cgggcgaggc attccgcctc gatgccgcgg aggccgccgc cctgttcgcg       360
     gagaataccg ccctgcgccg tctggggctc gcctacatcc aggcggtcat ggtgcagggc       420
     gctcagctga gcctgtgcaa tgcgcgccat tccatgaagc accgcgtgcg gcgctggctg       480
     ctcctcgccc aggactggct gggggagccg gaaatcgccg tcagccacca gctcatcgcg       540
     ggcctgctcg gcgtcaggcg ggcgagcgtg agcgagcaga tcgaacgtct ggagcaggcc       600
     gggatcgtgc gccagcagcg ggcctccatc acggtgctct gccgcgaggc cctggagcag       660
     gacagctgcg aatgccatgc gctcatcagc gcggaatacc ggcggctctt cacccgcagg       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page