(data stored in ACNUC7421 zone)

EMBL: CP001349.PE404

CP001349.PE404       Location/Qualifiers
FT   CDS_pept        465273..467066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0414"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: met:M446_2089 thiamine pyrophosphate binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55456"
FT                   /db_xref="GOA:B8IC68"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC68"
FT                   /inference="protein motif:PFAM:PF02776"
FT                   /protein_id="ACL55456.1"
FT                   /translation="MAETVGDFVCQRLSDWGVRTIFGYPGDGINGLLGAMQRHDPPFAF
FT                   IQVRHEEMAAFMACAYAKFTGELGVCLATSGPGATHLITGLYDARLDHMPVLAIVGQQA
FT                   RNALGGHYQQELDLTSAFKDVAGAFVQQASAPAQVRHLVDRAVRIARAGRQVTALVLPN
FT                   DLQDAPYEDPPRKHGTLQSGVGYSDPRVLPKDADLKQAAAVLNAGERVAILVGAGALHA
FT                   ADEVIAVAERLQAGAAKALLGKAALPDDLPWVTGSIGLLGTKPSWDLMTECDTLLMIGS
FT                   GFPYAEFLPKPGQARGVQIDLKAEMLSLRYPMEVPLVGDSEETLRALLPLLNQKPTGGE
FT                   WRNRIEEGVTAWWKEAGDRAMAKANPVNPQRVTWELSPRLPDRAIITSDSGSCANWFAR
FT                   DLKIRRDMMCSLSGGLASMGAAVPYAIAAKVAHPDRPVIALVGDGAMQMNNMAELITVA
FT                   KYRHLWPNQTWICCVFNNEDLNQVTWEQRVQAGNPKYEATQVIPNVPYHRFAELIGLKG
FT                   LYVDDPERVGTAWDEALASPVPVVLEVKTDPEVPPLPPHITLEQARNFMAMLWQGEPKE
FT                   GHLLADTARQVLSRVLPGEGG"
     atggctgaaa cggtcggtga tttcgtctgt cagcgcctct ccgactgggg tgtgaggacg        60
     atcttcgggt acccgggcga cggcatcaac gggctgctcg gggcgatgca gcgccacgac       120
     ccgccctttg cgttcatcca ggtgcggcac gaggagatgg cggccttcat ggcctgcgcc       180
     tacgccaagt tcacgggcga gctcggcgtc tgcctcgcga cctccgggcc gggggcgacc       240
     cacctgatca ccggcctcta cgacgcccgc ctcgaccata tgccggtgct cgccatcgtg       300
     ggccagcagg cccgcaacgc gctcggcggc cattaccagc aggaactcga cctcacgagc       360
     gccttcaagg acgtggccgg cgccttcgtg cagcaggcga gcgccccggc gcaggtgcgc       420
     cacctcgtcg accgggcggt gcgcatcgcc agggcgggcc gtcaggtcac cgccctcgtg       480
     ctgccgaacg acctgcagga cgctccctac gaggatccgc cgcgcaagca cggcaccctg       540
     caatcgggcg tcggctacag cgatccgcgc gtgctgccca aggatgccga cctgaagcag       600
     gccgccgcgg tgctgaatgc gggcgagcgg gtggcgatcc tggtgggggc cggcgcgctg       660
     cacgccgcag acgaggtgat cgcggtggcc gagcggctcc aggccggcgc cgccaaggcg       720
     ctcctcggca aggcggccct gcccgacgac ctgccctggg tgacgggctc gatcgggctc       780
     ctcggcacca agccgagctg ggacctgatg acggagtgcg acacgctcct gatgatcggt       840
     tccggcttcc cctatgcgga gttcctgccg aagccgggcc aggcccgcgg cgtgcaaatc       900
     gacctcaagg ccgagatgct ctcgctgcgc tacccgatgg aggtgccgct cgtcggcgat       960
     tccgaagaga ccctgcgcgc cctgctgccg ctcctgaacc agaagcccac gggcggcgaa      1020
     tggcggaacc gcattgagga gggcgtcact gcatggtgga aggaggcggg cgaccgcgcc      1080
     atggcgaagg cgaacccggt caatccccag cgggtgacct gggagctgtc gccgcgcctg      1140
     cccgaccggg ccatcatcac ctcggattcc ggctcctgcg cgaactggtt cgcccgcgac      1200
     ctgaagatcc ggcgggacat gatgtgctcg ctctcgggcg gcctcgcctc gatgggggcg      1260
     gccgtgccct acgccatcgc cgccaaggtc gcgcacccgg accggccggt gatcgccctc      1320
     gtgggcgacg gcgccatgca gatgaacaac atggccgagc tgatcacggt cgcgaagtac      1380
     cggcatctct ggccgaacca gacctggatc tgctgcgtgt tcaacaacga ggacctgaac      1440
     caggtgacct gggagcagcg cgtccaggcg gggaacccga aatacgaggc gacccaggtg      1500
     atcccgaacg tgccctatca ccgcttcgcc gagctgatcg gcctgaaggg cctctacgtg      1560
     gatgatcccg agcgcgtcgg caccgcctgg gacgaggcgc tggcgagccc cgttccggtg      1620
     gttctggagg tgaagaccga ccccgaggtc ccgccgctcc cgccccacat caccctggaa      1680
     caggctcgga atttcatggc gatgctctgg cagggggagc ccaaggaagg gcatctcctc      1740
     gccgacacgg cccggcaggt gctctcccgc gtcctgcccg gcgagggcgg ctga            1794
//

If you have problems or comments...

PBIL Back to PBIL home page