(data stored in ACNUC7421 zone)

EMBL: CP001349.PE405

CP001349.PE405       Location/Qualifiers
FT   CDS_pept        467070..468164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0415"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: met:M446_2088 mandelate racemase/muconate
FT                   lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55457"
FT                   /db_xref="GOA:B8IC69"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC69"
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /protein_id="ACL55457.1"
FT                   /translation="MRPEAPISAVSARAYAVPTDAPEADGTFAWRRTTLVVTAITAGSC
FT                   TGLGYTYSHAGDAGLIAGTLGPLLDGGDPFDVPALTARLWREVRNIGRAGMAATAISAL
FT                   DAALWDLKARLLGLPLVRLLGAARPAVPIYGSGGFTSYSDAQLTEQLAGFVGRDGCRAV
FT                   KIKIGSFPERDPARMRLARSAIGAAELFIDANGAFAPRAALAMAETARDFGVRWFEEPV
FT                   SSDDIAGLRFVRERVPAGIEVAAGEYAYDLDDIRRLLAAGAVDVQQADVTRCGGITGFL
FT                   AAGTLCAAHHTDLSGHCAPALHLHAACAVPRLRHLEWFHDHVRIEAMLFEGAPVPRDGQ
FT                   IAPDLTRPGHGLTFRQQDAERYAV"
     atgcgccccg aggccccgat cagcgccgtc tccgcccggg cctatgcggt cccgaccgac        60
     gcgccggagg cggacggcac cttcgcgtgg cgccgcacca ccctggtggt gacggcgatc       120
     accgcgggat cctgcacggg cctcggctac acctactcgc atgcggggga tgccggcctc       180
     atcgccggca ccctcggccc cttgctcgat gggggcgatc ccttcgacgt cccggccctg       240
     accgcccggc tctggcgcga ggtgcgcaac atcggccggg ccgggatggc cgcgaccgcg       300
     atctcggccc tcgacgccgc cctgtgggac ctgaaggcgc ggctcctcgg cctgccgctc       360
     gtgcgtctcc tcggggcggc gcggccggcc gtgccgatct acggcagcgg cggcttcacg       420
     agctactcgg acgcacagct caccgagcag ctcgccggct tcgtcgggcg cgacggctgc       480
     cgggccgtga agatcaagat cggcagcttc ccggagcgcg atcccgcgcg catgcgcctc       540
     gcgcgctcgg ccatcggcgc ggcggagctg ttcatcgacg cgaacggggc cttcgcgccg       600
     agggccgcgc tcgccatggc ggagaccgcg cgcgacttcg gcgtgcgctg gttcgaggag       660
     ccggtgtcga gcgacgacat cgcgggcctg cgcttcgtgc gcgagcgggt gccggccggc       720
     atcgaggtcg cggccggaga atacgcctac gacctcgacg atatccgccg cctgctggcg       780
     gcgggcgcgg tcgacgtgca gcaggcggat gtcacgcgtt gcggcgggat caccggcttc       840
     ctcgccgccg gcacgctctg cgcggcccat cacaccgact tgtcggggca ttgcgccccg       900
     gcgctgcatc ttcacgcggc ctgcgccgtc ccgcgcctgc gccacctcga atggttccac       960
     gaccacgtgc gcatcgaggc gatgctgttc gagggggcgc cggtgccgcg cgacgggcag      1020
     atcgcgcccg acctcacccg acccggccac gggctgacct tcaggcagca ggatgcggag      1080
     cgctatgcgg tttga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page