(data stored in ACNUC7421 zone)

EMBL: CP001349.PE406

CP001349.PE406       Location/Qualifiers
FT   CDS_pept        468154..469215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55458"
FT                   /db_xref="GOA:B8IC70"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC70"
FT                   /inference="similar to AA sequence:KEGG:M446_2087"
FT                   /protein_id="ACL55458.1"
FT                   /translation="MRFEIDAEDPPSPRAGSGAPVRPAGPVRPALGRPALGRPAVSARI
FT                   RLTAHPVAALACAAACIGAATWIAAGRSRKPAPGRPDGAAAEAARRLNRASTLLATSVL
FT                   LDSGLEHERGQYFNRAMVTPVLVSSAVLACSLHGAGPAGREASRLRHAVQAAAAVTGLA
FT                   GLGFHAYNVGKREGGYSWNNLFYAAPIGAPFALTLAGALGVAAEHVRAADPDHPRLLGL
FT                   PAGPLLAAGTAFGLAGTVGEAGLLHFRGAFHNPAMLLPVTVPPLAGALMAWAAWSPRGR
FT                   RPVTRAWLRATAALGLGGVALHAYGVSRAMGGWRNWRQNLLDGPPLPAPPAFTGIALAG
FT                   LAALDLMERHDHG"
     atgcggtttg agatcgacgc agaggatccg ccgagcccgc gggcgggatc cggcgcgccg        60
     gtccggcccg caggaccggt ccgtcccgca cttggccgac ctgcacttgg ccgacccgcg       120
     gtctcggccc ggatccggct gacggcgcat ccggtggcgg cgctcgcgtg cgcggcggcc       180
     tgcatcggcg ccgcgacctg gatcgccgcc ggccgctcgc gcaaaccggc gccgggccgg       240
     ccggacggcg ctgcggccga ggcggcgcgg cgcctcaacc gggcctcgac gctgcttgcg       300
     acctcggtgc tcctcgacag cggcctcgaa cacgagcgcg gccagtattt caaccgggcg       360
     atggtgacgc cggtcctggt gtcgagcgcg gtcctcgcct gctcgctcca cggcgccggc       420
     ccggccgggc gggaggcctc gcgcctgcgg cacgccgtgc aggccgccgc cgccgtcacc       480
     ggtctcgcgg ggctcggctt ccatgcctac aacgtcggca agcgcgaggg cggctattcc       540
     tggaacaacc tcttctatgc cgcgccgatc ggggcgccct tcgcgctgac gctcgcgggg       600
     gcgctcgggg tcgcggcgga gcatgtccgc gcggcggatc cggaccatcc ccgcctcctc       660
     ggcctcccgg ccggcccgct gctcgccgcc gggaccgcct tcggcctcgc cggcaccgtg       720
     ggcgaggcgg gcctgctgca tttccgcggc gccttccaca acccggcgat gctgctcccg       780
     gtgacggtcc cgcccctcgc gggcgccctg atggcctggg cggcctggtc cccgcgcggc       840
     cggcgccccg tcacgcgcgc atggctgcgg gcgacggcgg cgctcggcct cggcggggtc       900
     gcgctccatg cctacggcgt cagccgcgcc atggggggct ggcgcaactg gcgccagaac       960
     ctcctcgacg gccctcccct gccggccccg cccgccttca cgggcatcgc gctcgccggg      1020
     ctcgccgctc tcgacctcat ggagcgtcac gaccatggct ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page