(data stored in ACNUC7421 zone)

EMBL: CP001349.PE407

CP001349.PE407       Location/Qualifiers
FT   CDS_pept        469208..469882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55459"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC71"
FT                   /inference="similar to AA sequence:KEGG:M446_2086"
FT                   /protein_id="ACL55459.1"
FT                   /translation="MAEPKAVRRDLYPGYDVLAKRDGPSWNAQTRAVIDERLAIGPGTH
FT                   RFFTDAEFETLRAICARIVPQPPGEPDRIPVAALIDDRLHRGERDGYRDARMPPEDEAW
FT                   RRGLRALDAEALAAHGLRFHLLDEAAQDALLAAASRGELAQAAWGGMPCDLFFGQRLVD
FT                   DCVRAYYAHPAAWSEIGWGGPASPRGYVRMDFDRRDPWEAAEAKPGREEEARQANLRVG
FT                   RM"
     atggctgagc cgaaggccgt ccggcgcgat ctctatcccg gctacgacgt gctggcgaag        60
     cgcgacgggc cgtcctggaa cgcccaaacc cgcgccgtca tcgacgagcg gctcgccatc       120
     gggccgggga cgcaccgctt cttcaccgat gcggaattcg agaccctgcg ggcaatctgc       180
     gcgcgcatcg tcccgcagcc gcccggcgag ccggaccgca tcccggtggc tgccctgatc       240
     gacgaccgcc tgcaccgggg cgagcgggac ggctaccggg acgcgcggat gccgccggag       300
     gacgaggcat ggcgccgggg cctgcgggcg ctcgacgcgg aggccctggc cgcccatggc       360
     ctccgcttcc acctcctcga cgaagcggcc caggacgccc tgctggccgc cgcctcccgg       420
     ggggagctcg cccaggcggc ctggggcggc atgccctgcg acctgttctt cggccagcgg       480
     ctcgtcgacg attgcgtccg cgcctactac gcgcacccgg ccgcctggag cgagatcggc       540
     tggggcggcc cggcgagccc gcgcggctat gtgcggatgg atttcgatcg gcgcgacccc       600
     tgggaggcgg ccgaggccaa gcccggccgc gaggaggagg cccggcaggc caacctccgg       660
     gtcgggcgga tgtga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page