(data stored in ACNUC7421 zone)

EMBL: CP001349.PE408

CP001349.PE408       Location/Qualifiers
FT   CDS_pept        469890..471611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0418"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: met:M446_2085
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55460"
FT                   /db_xref="GOA:B8IC72"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC72"
FT                   /inference="protein motif:PFAM:PF00732"
FT                   /protein_id="ACL55460.1"
FT                   /translation="MRLPGTGGAADNPRFAVPDDDPMRVPRARDGRAPNVMRIGEWVPM
FT                   RQHRDDEEVDFAIVGTGAGGGTLACRLAEEGFSVVAFDAGPYWRPLEDFASDESHQSKL
FT                   YWTDERLVDGENPLQLGSNNSGRSVGGSTVHFAMVSLRFRPEWFRSRTLLGYGADWPID
FT                   WREMWDYYGQVEQALKISGPVTYPWGPKRPRYPYRAHELNAAARVLARGAEALGIGWAP
FT                   TPLATVSAPRGDSPPCVYRGFCTLGCSTNAKQSVLVTWLPRALRAGAEIRDLAMVGWIE
FT                   TSAGRATGLHYHREGRWRFQKARNVVVAGYAIETPRLLLMSANAEFPDGLANSSGLVGR
FT                   YLTVQGNQAVWGVMQQEIRSYKGPPSLALTEHWNYEDRGKDFFGGYCYMSQGPLPVLWS
FT                   RTLSGSRGLWGEALVAEMQRYNHVAGLKVVSEYMPQERNRVTLADETDQYGLPIPRITY
FT                   SWCDNDKAVNRHSLAFMRRALEAAGGGEIWEQENDTCHLNGTARMGSDPRTSVVDADCR
FT                   SWDIPNLWICDGSVFPTVGGVNPSLTIQAIALRTADRIAALAARGDLSGAARASSA"
     atgaggcttc ccggaaccgg cggcgccgcc gacaacccgc gcttcgccgt cccggacgac        60
     gatccgatgc gggtgccccg cgcccgcgac gggcgggcgc cgaacgtgat gcggatcggc       120
     gaatgggtgc ccatgcgcca gcaccgcgac gacgaggagg tcgacttcgc catcgtcggc       180
     acgggggccg gcggcggcac cctcgcctgc cgcctcgccg aggagggctt ctccgtcgtg       240
     gcgttcgacg ccgggcccta ctggcgcccg ctggaggatt tcgcctccga cgagagccat       300
     cagtccaagc tctactggac cgacgagcgc ttggtcgacg gcgagaaccc gctgcagctg       360
     ggctcgaaca actcgggccg gtcggtcggc ggctcgaccg tgcacttcgc catggtttcc       420
     ttacgcttcc ggcccgaatg gttccgctcc cggacgctgc tcggctacgg cgccgactgg       480
     ccgatcgact ggcgcgagat gtgggattat tacgggcagg tggagcaggc cctgaagatc       540
     tcggggcccg tcacctatcc gtgggggccc aaacgcccgc gctaccccta ccgggcgcac       600
     gagctgaacg cggccgcccg ggtgctggcg cgcggggccg aggcgctcgg gatcggctgg       660
     gcgccgacgc cgctcgccac cgtctcggcg ccccgcgggg actcgccccc ttgcgtctat       720
     cgcggcttct gcaccctcgg ctgctcgacc aacgccaagc agagcgtgct ggtgacctgg       780
     ctgccccgcg cgctccgggc gggagccgag atccgcgacc tcgccatggt cgggtggatc       840
     gagaccagcg ccgggcgcgc caccggcctg cactaccacc gtgaggggcg ctggcgtttc       900
     cagaaggccc gcaacgtggt ggtggccgga tacgcgatcg agaccccgcg cctgctccta       960
     atgtccgcca atgccgagtt cccggacggg ctcgccaatt cctcggggct cgtcggccgc      1020
     tatctcaccg tgcagggcaa ccaggccgtc tggggcgtca tgcagcagga gatccgctcc      1080
     tacaagggac cgccctcgct cgccctcacc gagcactgga actacgagga tcgcggcaag      1140
     gacttcttcg gcggctactg ctacatgagc caggggccgc tcccggtcct gtggagccgc      1200
     acgctctcgg gcagccgcgg cctgtggggc gaggcgctcg tcgccgagat gcagcgctac      1260
     aaccacgtcg ccggtctcaa ggtcgtctcc gagtacatgc cgcaggagcg caaccgcgtg      1320
     accctggcgg acgagaccga ccagtacggc ctgccgatcc cccgcatcac ctattcgtgg      1380
     tgcgacaacg acaaggccgt gaaccggcac agcctcgcct tcatgcgtcg cgccctcgaa      1440
     gccgcgggcg gaggcgagat ctgggagcag gagaacgaca cctgccacct caacggcacg      1500
     gcccgcatgg gcagcgatcc ccgcaccagc gtggtcgacg ccgattgccg ctcctgggac      1560
     attccgaatc tgtggatctg cgacggctcg gtcttcccga cggtcggcgg cgtgaacccc      1620
     tcgctcacca tccaggcgat cgccctgcgc accgccgacc ggatcgcggc gctcgccgcg      1680
     cggggcgacc tctccggcgc ggcccgcgcc tcatcagcct ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page