(data stored in ACNUC7421 zone)

EMBL: CP001349.PE409

CP001349.PE409       Location/Qualifiers
FT   CDS_pept        471627..472517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0419"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: met:M446_2084 SMP-30/gluconolaconase/LRE
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55461"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC73"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ACL55461.1"
FT                   /translation="MTPARIDILVQARAVIGEAPFWSGREPALYWIDVKAPALFRTDPE
FT                   TGDTRRWTLPAEIGGYALLADRSGAIVALRSGIFALAFASGDLDRLAGPPFDPRTHRFN
FT                   EGDCDPAGRLWLGTMFDPLPGVKAEPRADHLYAFTLAGGLVRHAETAFVANGFAWSPDG
FT                   GRLYLADSRAGRIDAVAFDAARGRLGLRQPFAAVPSGLGVPDGGAVDAEGFYWSAIHGG
FT                   SCLHRYAPDGRLDRRLPLPVRYPTMMAFGGGDLATLFVTSATHGEPGSPQDGAVLRLRP
FT                   GVRGEPRPLFGETRP"
     atgacgcccg cacggatcga catcctggtg caggcccggg cggtgatcgg cgaggcgcct        60
     ttctggtcgg ggcgggagcc ggcgctctac tggatcgacg tcaaggcccc ggccctgttc       120
     cgcaccgatc cggagacggg cgacacaagg cgctggacgc tgcccgcgga gatcggcggc       180
     tatgcgctcc tcgccgaccg gtccggcgcc atcgtcgccc tgcgctccgg gatcttcgcg       240
     ctcgccttcg cgagcggcga cctcgaccgg ctggccggtc cgcccttcga cccgcgcacg       300
     catcgcttca acgagggcga ttgcgatccg gccggacggc tgtggctcgg cacgatgttc       360
     gatccgctgc ccggcgtgaa ggccgagccc agagccgacc acctctacgc cttcaccctg       420
     gccgggggcc tcgtgcgcca cgccgagacg gccttcgtcg ccaacggctt cgcctggagc       480
     cccgacggag gccgcctcta ccttgccgac agccgggccg gccgcatcga cgcggtcgcc       540
     ttcgacgcgg cgcgcggacg gctcggcttg cggcagccct tcgcggccgt tccctccggt       600
     ctcggcgtgc cggatggcgg cgcggtcgac gccgaggggt tctactggag cgccatccac       660
     ggcgggagct gcctgcaccg ctacgcgccg gacggccgcc tcgaccgcag gctgcccctg       720
     ccggtccgct atcccaccat gatggccttc ggcggcggcg acctcgcgac cctcttcgtc       780
     accagcgcca cccacgggga gccgggctcg ccgcaggacg gagccgtgct gcggctgcgg       840
     ccgggcgtgc gcggagaacc gcgccccctc ttcggggaga cccgcccatg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page