(data stored in ACNUC7421 zone)

EMBL: CP001349.PE41

CP001349.PE41        Location/Qualifiers
FT   CDS_pept        44871..46067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0042"
FT                   /product="lytic murein transglycosylase"
FT                   /note="TIGRFAM: lytic murein transglycosylase; PFAM:
FT                   Peptidoglycan-binding domain 1 protein; KEGG: met:M446_0041
FT                   lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55093"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU48"
FT                   /inference="protein motif:TFAM:TIGR02283"
FT                   /protein_id="ACL55093.1"
FT                   /translation="MTRRARTTVATLLCLGGLALPGAAQADFRSCLAGLGREAAAHGIS
FT                   PSTFQSATAGIVYDDKVIELSQAQPEFKTPIWDYIAALVDEERVEDGRAAMRQYASALA
FT                   QAEARFNVDRYTIAAVWGVESNFGKNLGKMPLVQSLATLACSSNRRAGFFKGELMATLK
FT                   IIDRGDIEASRLTGSWAGAFGQTQFMPSTYQRLAVDLDGDGRRDVVDSVADAVGSTANF
FT                   LRVAKWQNGLPWGYEVRLPRGFNLAAAGRKSKRPVSHWASLGVTRIDGRQLTGEGQAGI
FT                   IAPAGIDGPAFLVTRNFDAIYSYNAAESYGLAIAILSDRLRGRSGIQTAWPTDDPPLSR
FT                   AERRALQSALASRGYDVGEPDGRVGAKTRDAIKDIERQLGWPQTGRPGAKVLEALRRG"
     atgacgcgtc gcgcgcgcac cacggtcgcc accctgctgt gcctcggcgg cctcgcgctg        60
     ccgggcgcgg cgcaggcgga tttccgctcc tgcctcgccg gtctcggccg ggaggcggcg       120
     gcgcacggga tctcgccgtc gaccttccag tcggcaacgg caggcatcgt ctacgacgac       180
     aaggtgatcg aactctcgca ggcccagccc gagttcaaga cgccgatctg ggactacatc       240
     gcggccctcg tcgacgagga gcgggtcgag gacgggcgcg cggcgatgcg ccaatacgcc       300
     tcggcgctcg cccaggcgga ggcgcgcttc aacgtcgacc gctacacgat cgcggcggtc       360
     tggggggtgg agtcgaactt cggcaagaac ctcggcaaga tgccgctggt gcagtccctc       420
     gcgaccctcg cctgcagctc caaccggcgc gccgggttct tcaagggcga gctgatggcg       480
     acgctcaaga tcatcgaccg gggcgacatc gaggcgagcc ggctgaccgg ctcctgggcc       540
     ggggccttcg ggcagacgca gttcatgccc tcgacctacc agcgcctcgc cgtcgacctc       600
     gacggcgacg ggcggcggga cgtggtcgat tcggtggcgg atgcggtcgg ctcgacggcg       660
     aacttcctgc gggttgccaa gtggcagaac gggctgccct ggggctacga ggtgcgcctg       720
     ccgcgcggct tcaatctcgc ggcggccggg cggaagtcca agcgcccggt cagccactgg       780
     gcgagcctcg gcgtcacgag gatcgatggg cggcagctca ccggcgaggg gcaggccggc       840
     atcatcgcgc ccgcgggcat cgacgggccg gccttcctgg tgacgaggaa cttcgacgcg       900
     atctattcct acaacgcggc ggagtcctac ggcctcgcca tcgcgatcct ctccgaccgc       960
     ctgcgcgggc ggtcgggtat ccagaccgca tggccgaccg acgatccgcc cctttcccgt      1020
     gccgagcgcc gggcgctcca gagcgcgctg gcgtcccgcg gctacgacgt gggcgagccg      1080
     gacgggcgcg tgggcgccaa gacgcgcgac gccatcaagg acatcgagcg ccagctcggc      1140
     tggccccaga ccggccgtcc cggcgccaag gtgctggagg cgctgcggcg cggctga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page