(data stored in ACNUC7421 zone)

EMBL: CP001349.PE410

CP001349.PE410       Location/Qualifiers
FT   CDS_pept        472514..473509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0420"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: met:M446_2083 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55462"
FT                   /db_xref="GOA:B8IC74"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC74"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL55462.1"
FT                   /translation="MTGGRPRAIVTGGTAGVGRAVAAEFARQGYDVAVLARGRRGLDAT
FT                   VAELRRLGARALGIEADVADAAAVFRAADEAASAFGGIDVWVNNAMVTMYAPVQRTHPD
FT                   EFRQVTAVTYLGQVHGTLAALRHMVPADRGTILCIGSALAYRSIPLQASYCAAKAAVRG
FT                   FVDSLRSELLHDGSRVRLTMVQLPAVNTPQFDWARSVLPRRLQPVPPIFQPEAIARHVV
FT                   RAARRAPREIWIGMPAWKAILGTMAAPGLIDRFLARQGYRGEMTDAPAVPGRPDNLFAP
FT                   VDTAPGAHGRFDARAHGRVVAARPSTLKAGLALGLLAGGALLAARRQWPR"
     atgaccggag gcaggccgag ggccatcgtc acgggcggga ccgcgggggt cgggcgggcc        60
     gtcgcggcgg aattcgcccg gcagggctac gatgtcgccg tgctggcgcg ggggcggcgc       120
     ggcctcgacg ccacggtcgc ggagcttcgg cggctgggcg cgcgggcgct cgggatcgag       180
     gcggacgtcg ccgatgcagc ggcggtgttc cgggccgccg acgaggccgc ctccgccttc       240
     ggcggcatcg acgtctgggt caacaacgcc atggtgacga tgtacgcccc cgtgcagcgc       300
     acgcacccgg acgagttccg gcaggtcacc gccgtcacct atctggggca ggtgcacggg       360
     acgctcgccg ccctccggca catggtgccg gccgaccggg gcaccatcct gtgcatcggc       420
     tcggcgctcg cctaccggtc gatcccgctc caggcgagct actgcgccgc caaggccgcc       480
     gtgcgcggct tcgtcgattc cctgcgcagc gagcttctcc acgacggcag ccgggtccgc       540
     ctcaccatgg tgcagctgcc ggccgtgaac acgccgcaat tcgactgggc gcgctccgtc       600
     ctgccgcgcc ggctgcaacc ggtgccgccg atcttccagc ccgaggccat cgcgcggcac       660
     gtcgtccgcg ctgcccgcag ggcgccccgc gagatctgga tcggcatgcc ggcctggaag       720
     gccatcctcg gcaccatggc ggccccgggc ctgatcgacc gcttcctcgc ccggcaggga       780
     tatcgcggcg agatgacgga tgccccggcc gtgccgggcc gccccgacaa cctcttcgcg       840
     ccggtcgata ccgccccggg cgcccatggc cgcttcgatg cccgcgcgca cggccgggtg       900
     gtggcggcgc ggccgagcac cctgaaggcc gggctggcgc tcgggctgct ggccggcggc       960
     gcgctcctgg cggcgcgccg gcaatggccc cggtga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page