(data stored in ACNUC7421 zone)

EMBL: CP001349.PE411

CP001349.PE411       Location/Qualifiers
FT   CDS_pept        complement(473856..475628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0421"
FT                   /product="PQQ-dependent dehydrogenase, methanol/ethanol
FT                   family"
FT                   /note="TIGRFAM: PQQ-dependent dehydrogenase,
FT                   methanol/ethanol family; PFAM: Pyrrolo-quinoline quinone;
FT                   KEGG: met:M446_2082 methanol/ethanol family PQQ-dependent
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55463"
FT                   /db_xref="GOA:B8IC75"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC75"
FT                   /inference="protein motif:TFAM:TIGR03075"
FT                   /protein_id="ACL55463.1"
FT                   /translation="MIRLLVLFALGLSALPARAGDSPAKPVLQTVDYANTRYAALDQID
FT                   AGNVGRLRVAWTFSTGVLRGHEGAPLVIGSIMVVHTPFPNVVSALDLDHEGRVLWRYSP
FT                   RQEANVIPVMCCDTVWRGPAYAGGRLFLQLADTTVVALDLATGRELWSVKNGDPARGET
FT                   NTATVLPVKDKLIVGISGGEYGARCHVTAYDQATGRRLWRAYAMGPDADMLIDPERTTE
FT                   LGRPVGRDSSLRSWEGDQWRLGGGCSWGWFSYDPDLDLVYYGTGNPSTWNPAQRPGGNR
FT                   WSMAILARDPDTGMARWVYQMTPHDQWDYDGVNEMILTDQDIDGRPRKLLTHFDRNGFG
FT                   YTLDRASGELLVAEKFDPSVNWARRIVMDPGSPAHGRPEIDPRYAPETAGEDETTTGIC
FT                   PGALGAKNQQPAAYSPQTRLFYVPTNHMCMDYEPFRVTYSPGQPYVGATLTLHPPAGAE
FT                   NTGAFIAWDGTRGRIAWSIPEPFSVWSGALATAGGIVFYGTLEGYLKAVDARTGRELYR
FT                   FKTPSGIVGNVTTYMHRGRQYVAVLSGIGGWAGIGLAAGLTDPAEGSGAVGGYAALSQY
FT                   TAPGGVLTVFALPE"
     ttgatcagac ttctcgtcct gttcgccctc gggctttccg cactgccggc tcgcgcgggc        60
     gattccccgg cgaagccggt cctgcagacg gtcgactacg ccaacacgcg ctacgcggcg       120
     ctcgaccaga tcgatgccgg caatgtcggc cggcttcggg tcgcctggac cttctcgacg       180
     ggggtgctgc gcggccacga gggcgcgccg ctcgtcatcg gcagcatcat ggtggtgcac       240
     acgcccttcc cgaacgtcgt ctccgccctc gacctcgacc atgagggccg ggtgctctgg       300
     cgctattccc cgcgccagga ggccaacgtg atcccggtga tgtgctgcga tacggtctgg       360
     cgcggtccgg cctatgcggg cgggcggctc ttcctgcagc tcgccgacac cacggtggtg       420
     gcgctcgacc tcgcgaccgg ccgcgagctg tggtcggtca agaacggcga tcccgcccgg       480
     ggcgagacca acacggcgac ggtcctgccg gtcaaggaca agctcatcgt cggcatctcg       540
     gggggtgagt acggagcccg ctgccacgtc accgcctacg accaggcgac gggccgccgg       600
     ctctggcgcg cctacgcgat ggggcccgat gccgacatgc tcatcgaccc ggagcggacg       660
     accgagctcg ggcgtccggt cggccgggat tcctcgctcc ggagctggga gggcgaccag       720
     tggcgcctcg gcgggggctg cagctggggc tggttctcct acgacccgga cctcgacctc       780
     gtctattacg gcaccggcaa tccctcgacc tggaacccgg cccagcgccc gggcggcaac       840
     cgctggtcca tggcgatcct cgcccgcgac ccggataccg ggatggcgcg ctgggtctac       900
     cagatgacgc cccacgacca atgggactac gacggcgtca acgagatgat cctgaccgac       960
     caggacatcg acgggcggcc gcgcaagctc ctgacgcatt tcgaccgcaa cggcttcggg      1020
     tacaccctcg accgggcgag cggcgagctg ctggtggcgg agaaattcga tccgagcgtc      1080
     aactgggcgc gccgcatcgt catggatccc ggctcgcccg cgcacggccg gcccgagatc      1140
     gacccgcgct atgcgcccga gacggcgggc gaggacgaga ccaccaccgg catctgtccc      1200
     ggggcgctcg gcgccaagaa ccagcagcct gcggcctact cgccgcagac gcgcctgttc      1260
     tacgtgccga cgaaccacat gtgcatggat tacgagccct tccgcgtcac ctacagcccg      1320
     ggccagccct atgtcggcgc gaccctgacc ctgcatccgc cggcgggtgc ggagaatacc      1380
     ggagccttca tcgcctggga cgggacccgg gggcggatcg cctggtcgat cccggagccg      1440
     ttctcggtct ggtcgggggc gctcgcgacg gcgggcggga tcgtgttcta cggaaccctc      1500
     gaaggctacc tgaaggccgt cgacgccagg acgggccggg agctgtaccg cttcaagacc      1560
     ccgtcaggca tcgtcggcaa cgtgaccacc tacatgcatc gcggccggca atacgtggcg      1620
     gtgctctcag ggatcggcgg ctgggccggc atcgggctcg ccgcgggtct cacggatccg      1680
     gcggagggct ccggcgccgt cgggggctac gcggccctgt cgcaatacac ggcgccgggc      1740
     ggcgtgctca cggtcttcgc gctgccggag tga                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page