(data stored in ACNUC7421 zone)

EMBL: CP001349.PE412

CP001349.PE412       Location/Qualifiers
FT   CDS_pept        475849..476589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0422"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: met:M446_6132 Crp/FNR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55464"
FT                   /db_xref="GOA:B8IC76"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC76"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACL55464.1"
FT                   /translation="MLVDTGSCDAFGTACSHRRPRNSCVDCKVRPISVCSVLALDELAV
FT                   LETLGQHLSLDKRQVLYGQEEPAEAVFNVIDGSLRLTRLLSDGRRQVMGFALPGDFLGL
FT                   AREDRFSVSAEALTPVTVCRFERRAFGALVDDKPHLLRSLHERAGHELTLAQDQMLLLG
FT                   RRTAEERVASFLVGLRERYARMGRASVTLELPMGRQDMADYLGLTIETVSRMLTRLDRE
FT                   RTVLIVPGGVRLLDPARLEALAAS"
     atgctggtgg acacgggttc gtgcgacgcg ttcgggacag cgtgctccca tcgtcggccc        60
     cggaatagct gcgtcgactg caaggtgcgt ccgatcagcg tctgctcggt tctcgccctc       120
     gacgagcttg ccgtgctgga gaccctcggc cagcacctga gcctcgacaa gcgccaggtc       180
     ctgtacgggc aggaggagcc ggcggaggcc gtgttcaacg tcatcgacgg gtcgctgcgg       240
     ctgacgcgcc tgttgtcgga cggacggcgg caggtgatgg ggttcgcgct gcccggcgac       300
     ttcctgggac ttgcccgcga ggaccgcttc tcggtctcgg ccgaggcgct cacgcccgtg       360
     acggtgtgcc ggttcgagcg ccgggccttc ggcgccctcg tcgacgacaa gccccatctg       420
     ctgcggagcc tgcacgagcg ggcgggccat gagctgaccc tcgcgcagga ccagatgctt       480
     ctcctcggcc gccgcaccgc ggaggagcgg gtcgcgagct tcctggtggg cttgcgggag       540
     cgctatgccc gcatggggcg tgcctcggtc actctcgaac tgccgatggg ccgccaggac       600
     atggccgatt atctcggcct caccatcgag accgtgagcc ggatgctgac ccgcctcgat       660
     cgggagcgca cggtcctgat cgtccccggc ggggtgcggc tgctcgatcc ggcccgcctg       720
     gaggccctgg cggcgagctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page