(data stored in ACNUC7421 zone)

EMBL: CP001349.PE413

CP001349.PE413       Location/Qualifiers
FT   CDS_pept        complement(476605..477420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0423"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: met:M446_6131 UspA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55465"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC77"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACL55465.1"
FT                   /translation="MSIASIMTSVDLGPGAAERVRLAAGLAARFEATLTGIAARPFPAA
FT                   GPIDRGVEIQAIADEGRARLADELRQVRSVFARGAGEGVRTAWQQGDGDPEGFLIRQSR
FT                   GADLVVVSRRGPRDPDPGPFGVAPDRILMEAARPVLVVPPGLEHLRGARIVVAWKDTPE
FT                   ALRAVSAALPFIVQADQVFVATAGEGARFEGGQDVAELLARHGAHVTTHLLSAPPRETT
FT                   DEILRFAARQDADLLVMGAYGHARLRQWLFGGATREILRMVPVCCLMSH"
     atgtctattg cgagcatcat gacctccgtc gatctcgggc cgggagcggc ggagcgggtt        60
     cgcctcgccg ccgggctcgc cgcccggttc gaggccacgc tgaccggcat tgccgcccgg       120
     ccgttccccg ccgcaggccc gatcgaccgc ggggtcgaga tccaggccat cgccgatgag       180
     gggcgggcgc gcctcgcgga cgagctgcgg caggtccgga gcgtcttcgc ccggggcgcc       240
     ggcgagggcg tccgcaccgc ctggcagcag ggcgatggcg atcccgaggg cttcctcatc       300
     cggcagagcc ggggcgccga cctcgtggtg gtctcccgcc gcgggccgcg cgatccggat       360
     ccggggccct tcggcgtcgc cccggaccgg atcctcatgg aggcggcccg gcccgtgctg       420
     gtcgtcccgc ccgggctcga gcatctgcgg ggggcccgga tcgtcgtcgc ctggaaggac       480
     actccggagg cgctccgggc ggtctcggcg gccctgccgt tcatcgtgca ggcggatcag       540
     gtcttcgttg cgaccgccgg ggagggggcg cggttcgagg gcggccagga cgtcgccgag       600
     ctgctcgccc ggcacggggc gcatgtgacc acgcatcttc tctccgcccc gccccgggag       660
     accaccgacg agatcctgcg cttcgccgcc cggcaggacg cggacctcct cgtgatgggc       720
     gcctatggcc atgcccgcct gcgccaatgg ctgttcggcg gcgcgacgcg ggagatcctg       780
     cgcatggtgc cggtctgctg cctcatgagc cactga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page