(data stored in ACNUC7421 zone)

EMBL: CP001349.PE414

CP001349.PE414       Location/Qualifiers
FT   CDS_pept        complement(477560..477823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC78"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55466.1"
FT                   /translation="MSAVALPEPGQPPIDAAWLAALQRMCMDLPIAMAGEMGDLMVAAI
FT                   APPTAEGDETVLGAAPQPDASPDPHREDLPSHDLPDIESCFA"
     atgagcgcgg tcgcactccc ggaaccgggc cagccgccca tcgacgcggc gtggctcgcc        60
     gccctgcagc ggatgtgcat ggatcttccg atcgcgatgg ccggcgagat gggcgacctc       120
     atggtcgcgg cgatcgcgcc tcccacggcg gaaggggacg agaccgtgct cggggccgcg       180
     ccgcagccgg acgcgtcgcc ggatcctcac cgcgaggatc tcccgtccca cgaccttccg       240
     gatatcgaga gctgcttcgc gtga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page