(data stored in ACNUC7421 zone)

EMBL: CP001349.PE415

CP001349.PE415       Location/Qualifiers
FT   CDS_pept        complement(477820..478215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55467"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC79"
FT                   /inference="similar to AA sequence:KEGG:M446_3595"
FT                   /protein_id="ACL55467.1"
FT                   /translation="MLSTITLTLARCAEYPEGSAGRGYQITAPLDPDGHLDQVRWREAR
FT                   DHCRVRRFWTGEPDRHGRLVHRAGGPGGATWLIDYDDRTAEDDETGYRLGVHRFVEGEY
FT                   VSVRGADEDGLHTFRVARVARAPGGPS"
     atgctgtcga ccatcaccct gaccctggcc cgctgcgccg agtatccgga aggcagcgcg        60
     ggacgcggct atcagatcac cgcgccgctc gatccggacg ggcatctcga tcaggtgcgc       120
     tggcgcgagg cgcgcgacca ttgccgggtg cgccgcttct ggaccggcga gcccgaccgc       180
     cacggccgtc tcgtgcaccg ggcgggcggt cccggcggcg cgacctggct gatcgattac       240
     gacgaccgca cggcggagga cgacgagacc ggctaccgcc tcggggtgca tcgcttcgtc       300
     gagggcgagt acgtgtcggt gcgcggcgcc gacgaggatg ggctccacac attccgggtg       360
     gctcgcgtcg cccgggcgcc gggaggcccg tcatga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page