(data stored in ACNUC7421 zone)

EMBL: CP001349.PE416

CP001349.PE416       Location/Qualifiers
FT   CDS_pept        complement(478231..478479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55468"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC80"
FT                   /inference="similar to AA sequence:KEGG:M446_6133"
FT                   /protein_id="ACL55468.1"
FT                   /translation="MSHVPHELTDEFPGQADRIRALKLADGRFAALVERYHAVNRAVHR
FT                   MEARIEPVSEETEQGTRRERMRLKDEIARMLDAEPAL"
     gtgtcccatg ttccgcacga gttgaccgac gagttccccg gccaagccga ccgcatccgc        60
     gcgctcaagc tcgcggacgg ccgcttcgcc gcgctggtcg aacgctacca cgcggtgaac       120
     cgcgccgtgc atcggatgga ggcccggatc gagccggtct cggaggagac ggagcagggc       180
     acgcggcgcg agcgcatgcg cctcaaggac gagatcgcgc ggatgctcga tgccgagccg       240
     gccctctga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page