(data stored in ACNUC7421 zone)

EMBL: CP001349.PE418

CP001349.PE418       Location/Qualifiers
FT   CDS_pept        complement(478936..481767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0428"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: met:M446_2081 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; GAF domain protein; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55470"
FT                   /db_xref="GOA:B8IC82"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC82"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACL55470.1"
FT                   /translation="MTHIATAPGATASRPGFAVGEAGRLAALRSYAILDTPREAEFDDI
FT                   AQMAAQACGTPMAHINFIDAHRQWIKAAVGHDMREMPLEFGFCTELLGSPDILLLSGLD
FT                   ADPGRSGNVLVAGAPHLRFYAGVPLVTPDGYAIGTLCVLDRVPRTLTEPQRFILKALAR
FT                   TVMAQLEMRRTDAALRASEERYRSLFNSIDAGFCVVEMEFDAAGRAADCRFLEVNPAFE
FT                   AQTGLVGAVGRRLRDLDPDHDQPWFDISGQVALTGRPVRFENAAPALKRWYDVHAYRVD
FT                   DPARHRVAILFNDITRRRENEMALLEREAESRLVADAMPALIAAIDRSFTYRFVNAAYE
FT                   TWFGHPREAVLGRTMSELIGPAEFAFRRPYVERALAGEEVRLERNWPWPDGRPRVADIR
FT                   YLPRRTPEGSIDGVYVFVHDVTDRKRVEDFLEAKAQSLEAQIAAQARDRDRIWTLSPVL
FT                   KVVATARGEVLSVNPSWVRTLGWSEAESLGRSLLDFVAPEDRDVMTGELERRLSGVPGG
FT                   DIEVAFLTQTGEPRRILWTIVPEEGTLYGFGRDVSEQRRAEEALRQSQKLEAVGQLTGG
FT                   VAHDFNNLLTIIRSSVDFLRRPDLPEERRRRYLDAVSDTVDRAAKLTGQLLAFARRQAL
FT                   KLEVIDVGVRLQAVAEMLDAVTGARIRVVTQVPDRPCFVRTDLSQFETALVNIAVNARD
FT                   AMNGEGTLTLRLACGCALPAIRGHAGAPGPFAAVSLTDTGAGIPPDLIGRIFEPFFTTK
FT                   EVGRGTGLGLSQVFGFAKQSGGDIAVESTPGQGTTFTLYLPQVEMADGLAGGDPDARSL
FT                   SPAGNGRRVLVVEDNVEVGRFACQILQDLGFTPEWASNAEEALERLEPDGAGFDAVFSD
FT                   VVMPGMGGIALARELRRRLPCLPVVLASGYSHVLAQEGAHGFELLHKPYSGEELGRLLH
FT                   RVTARAPAAPHGG"
     atgacccaca tcgcgacagc accaggggcg accgccagca ggcccggctt cgccgtcggc        60
     gaggccgggc gcctcgcggc cctgcgcagc tatgccatcc tcgacacacc gcgcgaggcc       120
     gagttcgacg acatcgccca gatggcggcc caggcctgcg ggacgccgat ggcgcatatc       180
     aatttcatcg atgcgcaccg gcagtggatc aaggccgcgg tcgggcacga catgcgggag       240
     atgcctctcg aattcggctt ctgcacggag ctgctcggct cgccggacat cctcctcctg       300
     tccggtctcg acgccgatcc gggccgctcc gggaacgtgc tcgtcgcggg cgccccgcac       360
     ctgcgcttct atgccggcgt gcccctggtc acgccggacg gatacgccat cgggacgctc       420
     tgcgtcctcg accgcgtgcc ccggaccttg accgagccgc agcgtttcat cctcaaggcc       480
     ctggcccgga ccgtgatggc gcagctcgag atgcgccgga cggacgcagc cctgcgcgcc       540
     agcgaggagc gctaccgctc cctcttcaac tcgatcgatg ccgggttctg cgtcgtcgag       600
     atggagttcg acgcggcggg ccgggccgcc gattgccggt tcctcgaggt caatccggcc       660
     ttcgaagccc agacgggcct cgtgggcgcg gtgggtaggc ggctgcgtga cctcgacccg       720
     gaccacgacc agccctggtt cgacatctcc gggcaggtgg cgctgacggg gcggccggtg       780
     cgcttcgaga atgccgcgcc ggcgctcaag cgatggtacg acgtccatgc ctaccgggtg       840
     gacgacccgg cccggcatcg cgtcgccatc ctgttcaacg acatcacgcg gcggcgcgag       900
     aacgagatgg cgctgctcga gcgcgaggcc gaatcgcggc tcgtggcgga tgcgatgccg       960
     gcgctgatcg ccgcgatcga ccggagcttc acctaccggt tcgtgaacgc cgcctacgag      1020
     acgtggttcg ggcatccgcg cgaggccgtt ctgggccgga ccatgagcga gctgatcggg      1080
     ccggcggagt tcgccttccg ccgtccctat gtggagcggg cgctcgccgg ggaggaggtg      1140
     cggctcgaac ggaactggcc ctggcccgac ggccgtccgc gcgtcgccga tatccgctac      1200
     ctgccgcgcc gcacgcccga gggctcgatc gacggcgtct acgtcttcgt tcacgacgtc      1260
     accgatcgca agcgcgtcga ggatttcctg gaggcaaagg cccagtccct ggaggcgcag      1320
     atcgccgccc aggcccgcga ccgcgaccgc atctggaccc tgtcgccggt gctcaaggtc      1380
     gtggcgacgg cgcggggcga ggtcctgtcg gtgaacccct cctgggtccg caccctcggc      1440
     tggtcggagg ccgagagcct cgggcgctcc ctcctcgact tcgtggcccc ggaggaccgc      1500
     gacgtgatga cgggcgagct ggagcggcgc ctgtccggcg tgccgggcgg cgacatcgag      1560
     gtcgcgttcc tcacccagac cggcgagccg cggcgcatcc tgtggaccat cgtgccggag      1620
     gaggggacgc tctacggctt cggccgcgac gtctccgaac agcggcgggc cgaggaggcg      1680
     cttcggcagt cgcagaagct cgaagcggtg ggccagctca ccgggggcgt ggcgcacgac      1740
     ttcaacaacc tgctcaccat catccgctcg tcggtcgatt tcctgcgccg gcccgacctg      1800
     cccgaggagc gccggcggcg ctatctcgat gcggtctccg acacggtcga ccgcgcggcc      1860
     aagctcaccg gccagctcct cgccttcgcc cgccgccagg cgctcaagct cgaggtcatc      1920
     gacgtcgggg tgcggctgca ggccgtggcg gagatgctcg atgcggtgac gggcgcgcgc      1980
     atccgggtgg tcacgcaagt tccggaccgg ccctgcttcg tgcgcacgga cttgagccag      2040
     ttcgagaccg cgctggtgaa catagcggtc aatgcgcgcg atgcgatgaa cggcgagggc      2100
     acgctgacgc tgcggcttgc gtgcggctgc gcgctgccgg ccatccgcgg ccatgcgggg      2160
     gcgcccggcc ccttcgcggc ggtgtcgctg accgataccg gcgccggcat cccgccggac      2220
     ctgatcgggc gcatcttcga gccgttcttc accaccaagg aggtcggccg cggcaccggg      2280
     ctcggcctgt cccaggtctt cggcttcgcc aagcagtcgg gcggcgacat cgcggtcgag      2340
     agcacccccg gccagggcac gaccttcacg ctctacctgc cgcaggtcga gatggcggat      2400
     gggctcgcgg ggggcgatcc ggatgcccgc tccctgtccc cggcgggcaa tggccgccgg      2460
     gtgctggtgg tggaggacaa tgtcgaggtc ggccgcttcg cctgccagat cctgcaggat      2520
     ctcggcttta cgccggaatg ggcgtcgaat gccgaggagg cgctcgaacg gctggagccc      2580
     gacggagcgg gtttcgacgc ggtgttctcg gacgtggtga tgcccggcat gggcggcatc      2640
     gcgctcgccc gcgagctccg ccgccggctg ccgtgcctgc cggtggtgct ggcctccggc      2700
     tacagccacg tgctggcgca ggagggcgcg cacgggttcg aactgctgca caagccctat      2760
     tccggggagg agctgggccg cctcctgcac cgcgtgaccg cgcgggcccc cgccgcgccg      2820
     cacggcggat ag                                                          2832
//

If you have problems or comments...

PBIL Back to PBIL home page