(data stored in ACNUC7421 zone)

EMBL: CP001349.PE419

CP001349.PE419       Location/Qualifiers
FT   CDS_pept        482216..484447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0429"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: mpo:Mpop_0141 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55471"
FT                   /db_xref="GOA:B8IC83"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC83"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACL55471.1"
FT                   /translation="MLGLFSCLTNEHIPHLLALNVLLAAATAFAMLSFLAAGRGLNGAW
FT                   TPLRQGFAGPAVALFAAGFAALHLLGPVGTVVPGRIVWDTGLAAGAVLSGTMLAAGAIR
FT                   LAIRRPGVPACIAASFLLALGLCGLQVLALAAASVVPDAPPLPTPLLSRDAIAGAVAAA
FT                   SALLLAVATHGIVADARAAALRNAVARLRALTEASFEGIVVVRDGRVLDVNPSFCALIG
FT                   RPAEALRGEALAALTDPDSLPLLAGAESPASHETRLRCADGTTVPVEVRARPWSTGDAA
FT                   YAIAVRSLRERHEADRRIRMLAYRDQATSLPNRAAFDEALRAQITACVRNNTTFSLHRI
FT                   DLDRFKDINITFGHALADQVLAGLARRLAQVVEAGTLDRVFRLGDDEFAVLQIDSERAR
FT                   PPETVARQIVEHLAAPVVVADRQVQIRASVGVAVWPEDGSGGEMLLKRSGLALDRAKRD
FT                   GGGRHCRYDESLVAAIEARRRLQEDLAAGLRDGAFTIVYLPIVSFASRRIVGHEALLRW
FT                   RHPRLGEIPPSRFIPLAEECGAIVDLGQLVLAEACRQAATWTEDHLVAVNVSGPQLQTD
FT                   DFIDLVDAVLRQTGLPPERLQIEVTEAILIDDRHRVAQRLRTLRARGVRVALDDFGKGL
FT                   SSLQLPRDIPFDAVKLDVSIIRGLVQGREQRAVVEALIGLLHHLGRVTVAEGVETREQW
FT                   EALRAAGCDLAQGVLFGTPRAQPIAGDVLIEPLPPAVTRLSDYLRRRDG"
     atgcttggcc tgttctcatg ccttacgaac gagcacattc cgcatctgct tgcgctgaat        60
     gtgcttctgg ccgcagcgac cgcctttgca atgctgtcgt tcctggccgc gggccggggc       120
     ctgaacgggg cctggactcc gctgcggcag ggtttcgccg gccccgcggt cgccctcttc       180
     gcggccggct tcgcagccct tcacctcctc ggccctgtag ggacggtcgt cccgggccgg       240
     atcgtctggg acaccggact cgcggcgggc gcagtgttgt ccgggacgat gctcgcggcc       300
     ggcgcgatcc gcctcgcgat ccggcgaccg ggcgttccgg cgtgcatcgc ggcgagcttc       360
     ctgctggcgc tcggcctctg cggcctccag gttctggcgc tcgcggccgc gagcgtcgtg       420
     ccggatgccc cacccctgcc cacgcccctg ctgtcgcggg acgcgatcgc cggggccgtc       480
     gcggcggcga gcgcgcttct cctggcggtc gccacgcatg gcatcgtggc cgatgcgcgg       540
     gccgccgccc tgcgcaacgc cgtcgcccgc ctgcgggccc tgaccgaggc gtccttcgag       600
     ggcatcgtcg tcgtccggga cggccgcgtc ctcgacgtca atccgagctt ctgcgcgctg       660
     atcggccggc cggccgaggc cctgcggggc gaggcgctcg cggccctgac ggatccggac       720
     agcctaccac tgcttgccgg tgcggagagc cccgcctcgc acgagacgcg cctgcgctgc       780
     gccgacggga ccaccgttcc ggtggaggtc cgcgcgagac cctggtccac gggggatgcc       840
     gcctacgcca ttgcggtgcg cagcctgcgg gaacggcacg aggccgaccg gcgcatccgc       900
     atgctggcct atcgcgacca ggcgacgagc ctgccgaacc gcgccgcctt cgacgaggcg       960
     ctgcgggcgc agatcaccgc ctgcgtgcgc aacaacacca cgttctcgct gcatcgcatc      1020
     gatctcgacc ggttcaagga catcaacatc accttcgggc atgccctcgc cgatcaggtg      1080
     ttggcggggc tcgcccggcg cctcgctcaa gtcgtcgagg ccggaaccct ggaccgggtc      1140
     ttccgtctcg gcgacgacga gttcgccgtg ctccagatcg acagcgagcg cgcccgcccg      1200
     cccgagaccg tggcccggca gatcgtcgag catctcgccg ccccggtcgt ggtcgcggac      1260
     cggcaggtgc agatccgcgc cagcgtcggc gtcgcggtct ggccggagga cgggtcgggg      1320
     ggtgagatgc tcctcaagcg ctcgggcctc gcgctcgacc gggccaagcg cgacggcggc      1380
     gggcggcatt gccgctacga cgagtccctc gtcgcggcga tcgaggcgcg ccgccggctg      1440
     caggaggatc tcgccgcggg tctgcgcgac ggcgccttca ccatcgtcta cctgccgatc      1500
     gtgtccttcg cctcccggcg catcgtcggc cacgaggcgc tgctgcgctg gcggcatccg      1560
     cgcctgggcg agattccgcc gagccgcttc atcccgctgg ccgaggaatg cggcgcgatc      1620
     gtcgatctcg gccagctcgt cctggcagaa gcctgccgcc aggcggcgac ctggacggag      1680
     gatcacctcg tcgcggtgaa cgtctcagga ccgcagctcc agacggacga cttcatcgat      1740
     ctcgtggacg ccgtgctcag gcagaccggc ctgccgcccg agcgtctgca gatcgaggtc      1800
     acggaggcga tcctgatcga cgaccgccac cgggtggcgc agcgcctgcg gaccctgcgg      1860
     gcgcggggcg tgcgcgtcgc gctcgacgat ttcgggaagg gcctctcgtc cctccagctt      1920
     ccgcgcgaca tcccgttcga tgccgtgaag ctcgacgtct cgatcatccg cggtctcgtg      1980
     cagggccgcg aacagcgcgc cgtggtcgag gcgctgatcg gcctgctgca ccatctcggc      2040
     cgcgtgacgg tggcggaggg ggtggagacc cgcgagcagt gggaggcgct gcgggccgcc      2100
     ggatgcgacc tcgcgcaggg cgtgctgttc gggacgccgc gtgcgcagcc gatcgccggc      2160
     gacgtcctca tcgagccgct gccgcccgcc gtcacccgcc tcagcgacta cctgcgccgc      2220
     cgggacgggt ga                                                          2232
//

If you have problems or comments...

PBIL Back to PBIL home page