(data stored in ACNUC7421 zone)

EMBL: CP001349.PE42

CP001349.PE42        Location/Qualifiers
FT   CDS_pept        complement(46344..47576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0043"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   met:M446_0043 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55094"
FT                   /db_xref="GOA:B8IU49"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU49"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL55094.1"
FT                   /translation="MQTIRESRPRDGRENEAGREAARLRRPLWIALGLMLIAFNLRPAL
FT                   SSVGPLLARIREDTGMSGALAGALITLPVLCLGVFGRLGPPVTRRLGPDAGVLAFLIVI
FT                   AAGLVLRGFGGLPALFAGSVLAAGGIGVVGVILPGIVKRDFPERPGLMMGLYTAVLCLG
FT                   AAAGAGLTVPAGRLLESGWQGPMMIWALPVLLAALAWLPFVRAAPASPGLGPRRFAALW
FT                   RDRLAWQVTGFMGLQSSLAYIVFGWLPAALTDRGFDPLAAGLVASLSAMAQTVLALLVP
FT                   TLAGRSRDQRPWVLLVVGLAVGGFCGLLVGPIGLVWPFALMLGLGLGGCFGLALTLIVL
FT                   RSPDAQTAGDLSAMAQGVGYTLAALGPLLIGLAHDASDGWGIPAALYGGLGLAAATLGL
FT                   LAARNRHVLAR"
     ttgcagacga tccgggagag ccggccgcgg gacggccgcg agaacgaggc cggccgggag        60
     gccgcgcggc tgcgccgccc gctctggatc gccctcggcc tcatgctgat cgccttcaac       120
     ctgcggccgg ccctctccag cgtcggaccg ctgctggccc gcatccgcga ggataccggc       180
     atgagcggcg cgctcgcggg agcgctcatc accctgccgg tgctctgcct cggggtgttc       240
     gggcggctcg ggccgccggt gacgcgccgc ctcgggcccg atgccggcgt gctcgccttc       300
     ctcatcgtca tcgccgccgg attggtgctg cgcggattcg gcggcctgcc ggccctgttc       360
     gccggatccg tcctggcggc gggcggcatc ggcgtcgtcg gcgtgatcct gcccggcatc       420
     gtcaagcgcg actttcccga gcggccgggc ctgatgatgg gcctctatac ggcggtgctg       480
     tgcctgggcg ccgcggcggg ggcggggctc accgttccgg cgggccgcct gctcgaatcc       540
     ggctggcagg gcccgatgat gatctgggcc ctgccggtgc tccttgccgc cctcgcgtgg       600
     ctgcccttcg tgcgagcggc gcccgcatcg ccgggcctcg ggccgcgccg gttcgcggcg       660
     ctctggcgcg accggctggc ttggcaggtc acgggcttca tgggcctgca atcctcgctc       720
     gcctacatcg tgttcggctg gctgccggcc gccctgacgg accggggctt cgacccgctc       780
     gcggcgggcc tcgtcgcctc gctctcggcc atggcccaga cggtgctggc gctcctcgtg       840
     ccaacgctgg ccggccggag ccgggaccag cgcccgtggg tgctgctcgt cgtcgggctc       900
     gcggtcgggg gattctgcgg cctgctggtg gggccgatcg gcctcgtctg gcccttcgcc       960
     ctgatgctcg gcctcgggct cggcggctgc ttcggccttg ccctcactct gatcgtgctg      1020
     cgctcgcccg acgcgcagac ggccggcgat ctctcggcca tggcgcaggg cgtcggctat      1080
     accctcgcgg cgctcggacc gctcctgatc gggctcgcgc acgatgcgag cgacggctgg      1140
     ggcatcccgg cggcgctcta tggcggcctc ggcctcgccg cagccacgct cgggctcctc      1200
     gctgcccgca accgtcacgt cctggcgcga tag                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page