(data stored in ACNUC7421 zone)

EMBL: CP001349.PE420

CP001349.PE420       Location/Qualifiers
FT   CDS_pept        485121..486401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55472"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC84"
FT                   /inference="similar to AA sequence:KEGG:M446_2080"
FT                   /protein_id="ACL55472.1"
FT                   /translation="MPIALSFPLHGGWGLADLGAFGHAERDGRPTALGRRARETSTVAG
FT                   LQMVLDPPSASAAAATRPARRAGPLAASLIALLSLTVSGDWHPAEAPPAPTGSRGQAEA
FT                   PPAPVEEAPPAVTRADAAPAPPVQGLSVETPVPWQSALLDSVLEAALAPPSDPVEAPAS
FT                   ETPDEARTAAPDDLSQDPARLAQPVPLPVPRPPELRRPRTAEPARGASRSAAQRAGVAS
FT                   PLPPVEDNRSFIEKLFDLPPASSPGLAYAALESNPVVPAPNRRLSPVPGPDVARATAVY
FT                   DISARTVTLPNGERLEAHSGLGPHMDDPRFVHVRMRGATPPGTYDLTEREKLFHGVRAI
FT                   RLTPVGGSGAVHGRVGLLAHTYMLGPSGASNGCVSFKDYNRFLQAFLRGEVQRLVVVAG
FT                   RGQDGPPGTNDRRIGLSDRPAAGGNGA"
     atgccgatag cgctgagctt tcctctgcac ggcggatggg gcctcgccga tctgggcgcc        60
     ttcgggcacg cggagcgcga cggccggccc accgcgctag gcagacgagc cagggagacg       120
     agcacggtgg ccggcttgca gatggtcctc gaccccccat cggcgagcgc cgcggcggcg       180
     actcgtcccg ctcgccgcgc cgggccgctc gcagcctccc tcatcgctct gctgagcctc       240
     accgtcagcg gggactggca cccggccgag gcgcccccgg ccccgaccgg aagccgcggg       300
     caggccgagg cgccgcccgc cccggtcgag gaggccccgc cggccgtgac ccgcgccgat       360
     gcggctccgg ctccccccgt gcagggcctg tccgtcgaaa cgcccgtgcc ctggcagagc       420
     gccttgctcg attccgtgct ggaggcggcc ctggccccac catccgatcc ggtcgaggcg       480
     ccggcttcgg agaccccgga cgaggcgcgc accgccgcgc cggacgacct gagccaggat       540
     cccgcccggc tcgcccagcc cgtgcccctg ccggtgccgc gcccgcctga actgcgccgt       600
     ccgcgaacgg cggagccggc ccgcggcgcg agccggtccg cggcgcagcg cgcaggcgtc       660
     gcctcgcccc tccccccggt cgaggacaac cgctccttca tcgagaagct gttcgatctt       720
     ccgccggctt cgagccccgg cctcgcctat gcggcgctgg agagcaaccc cgtcgtcccg       780
     gcgccgaacc ggcgcctcag ccccgttccg gggccggacg tggcccgggc gaccgccgtc       840
     tacgacatca gcgcccgcac cgtgaccctg ccgaacggcg agcggctgga ggcccattcc       900
     ggcctcggcc cgcacatgga cgacccgcgc ttcgtgcatg tgcgcatgcg cggcgccacg       960
     ccgcccggca cctacgacct gaccgagcgc gagaagctct tccacggcgt gcgggcgatc      1020
     cgcctcacgc cggtgggcgg cagcggcgcc gtacacgggc gggtcgggct cctggcgcat      1080
     acctacatgc tcgggccgag cggggcctcg aacggctgcg tctccttcaa ggactacaac      1140
     cgcttcttgc aggccttcct gcgcggagag gtccagcgcc tcgtcgtcgt cgccggccgc      1200
     gggcaggacg gaccgcccgg cacgaacgac cgccgcatcg gcctgtccga tcgtccggcc      1260
     gcgggcggca acggggcctg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page