(data stored in ACNUC7421 zone)

EMBL: CP001349.PE421

CP001349.PE421       Location/Qualifiers
FT   CDS_pept        complement(486561..487358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55473"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC85"
FT                   /inference="similar to AA sequence:KEGG:M446_2079"
FT                   /protein_id="ACL55473.1"
FT                   /translation="MINCGYGRPLVAAGFAAFVFTAHAAQAAQCGNGPAGFEAWKREFA
FT                   EEARGRVGATGVSALMGTSYSSATIAADRGQKSFRLSLDQFLAKRGGPAIVSRGRALKQ
FT                   SNAALFASIEQRYGVPPGPLLAIWGMETGFGASRGNVNTLSAVATLAYDCRRSAYFTDQ
FT                   LYAALTLVDRGILSPSTRGAAHGEVGHTQFLPKSILNYGTGGSLDSVPNALNATANFLR
FT                   AHGWQRGAGYQPGEPNFSAIQGWNSASVYQRAIALIGRRIDGE"
     atgatcaatt gcgggtacgg aaggcccttg gtcgcggcgg gtttcgcggc cttcgtgttc        60
     acggcccatg ccgcgcaggc tgcgcaatgc ggcaacggcc ccgccgggtt cgaggcgtgg       120
     aagcgggaat tcgccgaaga ggcgcgggga cgggtgggcg cgacgggcgt ctcggccctg       180
     atgggcacct cctattcctc ggcgaccatc gcggcggatc ggggccagaa gagcttccgc       240
     ctctcgctcg atcagttcct ggccaagcgc ggcggcccgg ccatcgtgtc gcgcgggcgg       300
     gcgctcaagc agtccaacgc ggcgctcttc gcctcgatcg agcagcgcta tggcgtgccg       360
     cccgggccgc tcctggcgat ctggggcatg gagacgggct tcggcgcgag ccggggcaac       420
     gtcaacaccc tgtcggccgt ggcgaccctg gcctatgatt gccgccgctc cgcctacttc       480
     accgaccagc tctatgccgc gctcaccctg gtcgaccggg gcatcctctc gccgagcacc       540
     cgcggcgcgg cccacggcga ggtcggccac acgcagttcc tgccgaagag cattctgaac       600
     tacggcacgg gcggcagcct cgacagcgtg ccgaacgccc tcaacgcgac cgcgaacttc       660
     ctgcgcgccc atggctggca gcgcggggcc ggctatcagc cgggcgagcc gaacttctcg       720
     gcgatccagg gctggaactc ggcttccgtc taccagcgcg cgatcgcgct gatcggcagg       780
     cgcatcgacg gcgagtag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page