(data stored in ACNUC7421 zone)

EMBL: CP001349.PE422

CP001349.PE422       Location/Qualifiers
FT   CDS_pept        487696..488814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0432"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; Male sterility domain; KR domain
FT                   protein; KEGG: met:M446_2078 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55474"
FT                   /db_xref="GOA:B8IC86"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC86"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55474.1"
FT                   /translation="MSQSILITGGAGFIGRAVARALVARGDRVRVLDSLIDQVHGGLGR
FT                   PDDLPDAVDLRRGDVRDPAAVAQSLIGIDKVIHLAAEVGVGQSMYAVERYVSVNDLGTA
FT                   VLFQALIERPVQRVVVASSMSVYGEGLYRDSEGALIEDVARQPRSGPEAPWDPLDARGR
FT                   PLKPVPTPEWKRPALASVYALSKYAQERLTLMLAPAYGMEGVALRLWNAYGPGQALSNP
FT                   YTGVLAIFASRLHNGAAPVIFEDGHQLRDFVQVDDVAQAFLLALDRREAAGQVYNIGSG
FT                   EYRSVREVATLLARAMGRTDIVPEIAGKMRAGDIRHCIPDIGKAKAELGYAPRRDFADG
FT                   LAELAAWVAAQQDAQDRVAEARRELEKRGLVA"
     gtgtcgcaga gcatcctgat caccggcgga gccggtttca tcggccgggc cgtcgcccgg        60
     gcgctggtcg cacggggcga ccgggttcgt gtcctcgaca gtctgatcga tcaggtgcat       120
     ggcggcctcg gccggccgga cgatctgccg gatgcggtcg acctgcgccg gggcgacgtg       180
     cgcgacccgg ccgccgtggc gcagtcgctg atcggcatcg acaaggtcat ccacctcgcc       240
     gccgaggtcg gcgtggggca gagcatgtac gcggtcgagc gctacgtctc ggtcaacgac       300
     ctcggcacgg cggtgctgtt ccaggcgctg atcgagcggc cggtgcagcg ggtcgtcgtc       360
     gcctcctcca tgagcgtcta cggcgagggg ctctaccgcg actcggaggg ggcgctcatc       420
     gaggacgtgg cgcgccagcc ccgctccggc ccggaggcgc cctgggatcc gctcgatgcg       480
     cggggccgcc cgctcaagcc cgtcccgacg cccgagtgga aacgcccggc cctcgcctcg       540
     gtctatgccc tgtcgaaata cgcgcaggag cgcctgaccc tgatgctcgc ccccgcctac       600
     ggcatggagg gcgtggcttt gcggctatgg aatgcctacg ggccgggcca agcgctctcg       660
     aacccctata cgggggtgct ggcgatcttc gcctcgcggc tccacaacgg ggccgcgccg       720
     gtgatcttcg aggatggcca ccagctgcgc gacttcgtgc aggtcgacga cgtggcgcag       780
     gccttcctcc tcgccctcga ccggcgcgag gccgcgggtc aggtctacaa tatcggctcg       840
     ggcgagtacc gctcggtgcg cgaggtggcg accctgctcg cccgcgccat gggccgcacc       900
     gacatcgtcc cggagatcgc cggcaagatg cgggccgggg acatccgcca ctgcatcccg       960
     gatatcggca aggccaaggc cgagctcggc tatgcgcccc ggcgcgactt cgcggacggc      1020
     cttgcggaac tcgccgcctg ggtggccgcg cagcaggatg cgcaggaccg cgtcgccgag      1080
     gcgcgccgcg aactcgagaa gcgcgggctc gtcgcatga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page