(data stored in ACNUC7421 zone)

EMBL: CP001349.PE423

CP001349.PE423       Location/Qualifiers
FT   CDS_pept        488811..489905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0433"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: met:M446_2077 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55475"
FT                   /db_xref="GOA:B8IC87"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC87"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55475.1"
FT                   /translation="MTSPGGLRPILITGGAGFIGANLADALAAEGRDVLIYDALLRPGV
FT                   EANLDWLKRRHPDRISAVVADVRDTAALAAAAGDAAAVFHFAAQVAVTTSLVEPATDFD
FT                   VNLGATLQLLEALRRRPDPAPLIFASTNKVYGDLADLAFRREGEAYRPADETLHRHGIG
FT                   EDRPLDFHTPYGCSKGGADQYVLDYARSFGVPTCVMRMSCIYGPRQMGTEDQGWVAHFL
FT                   IRALAEQPIAIYGDGYQVRDILHVADAVAAYRAALARIGQVSGRAYNLGGGPANAVSLR
FT                   QVLGAIRDLVAQPLDLSFHDWRAGDQRYYVSDTRRAAADLGLDAPIAWRTGLRDLARWL
FT                   AEARGLVLPEESAPRRLAASVSSA"
     atgaccagcc cgggcggatt gcggccgatc ctcatcacgg gaggggccgg cttcatcggc        60
     gcgaacctcg cggacgcgct cgcggccgag ggccgcgacg ttctgatcta cgacgccctg       120
     ctgaggccgg gcgtcgaggc caatctcgac tggctgaagc gccgccaccc ggaccggatc       180
     tcggccgtcg tggcggatgt gcgcgacact gccgccctgg ccgcggcggc gggcgatgcg       240
     gcggccgtgt tccacttcgc cgcccaggtc gccgtgacca cgagcctcgt cgaaccggcg       300
     acggatttcg acgtgaatct cggggcgacc ctgcagctgc tggaggccct gcgccgccgc       360
     cccgatcccg cccccctgat cttcgcctcg accaacaagg tctacggcga cctcgccgac       420
     ctcgccttcc ggcgcgaggg ggaggcctac cggcccgcgg acgagaccct gcaccgccac       480
     gggatcggcg aggaccgccc cctcgacttc cacacgccct atggctgttc gaagggtggc       540
     gccgaccagt acgtgctcga ctacgcccgc agcttcgggg tgccgacctg cgtgatgcgc       600
     atgagctgca tctacggccc gcggcagatg ggcaccgagg accagggctg ggtggcgcat       660
     ttcctgatcc gggccctggc ggagcagccc atcgccatct acggcgacgg ctaccaagtg       720
     cgcgacatcc tccacgtcgc cgatgcggtc gccgcctacc gggcggcgct ggcgcggatc       780
     gggcaggtga gcggccgggc ctacaatctg ggcggtgggc ctgcgaatgc cgtcagcctg       840
     cggcaggtgc tcggcgcgat ccgcgacctc gtcgcgcagc cgctcgacct ctccttccac       900
     gactggcggg ccggggacca gcgctactac gtgtcggata cccgccgcgc cgcggccgat       960
     ctcgggctcg acgccccgat cgcctggcgg accgggctgc gcgacctcgc ccgctggctc      1020
     gccgaggctc gcggcctcgt gctgccggag gagtccgcgc cacgccgcct ggccgcctcg      1080
     gtatcctccg cttaa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page