(data stored in ACNUC7421 zone)

EMBL: CP001349.PE424

CP001349.PE424       Location/Qualifiers
FT   CDS_pept        490003..491301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0434"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: met:M446_2076 radical SAM
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55476"
FT                   /db_xref="GOA:B8IC88"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR027559"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC88"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACL55476.1"
FT                   /translation="MRISLVNPTWTFTQSIYFGCREPHLPIELGACKVLLEAAGHDVLM
FT                   LDGALDGLSLEELADRVADFRPAMTVVTTAPTYLFWRCAQPELRVPRAFLDALGERGGR
FT                   TVVVGPHGSVTPETALTKLGCDFVVRGECEEVVAALASGGLERPDRVPALAYRDGLEIT
FT                   VTGGPAAARFADLPALSWPEAWIARHHHHHHRFDRAPDGPGAEVEASRGCPYTCTFCAK
FT                   IDFRDKYRRRDLTIILEEIDRLIAQGVTYLYFIDEIFLPQKPLLEALVGRAVSFGVQTR
FT                   IDLWKPDMLDLLGAAGCVSIEAGVESLTEEGRALLDKNCRVSTDDLAERLIHARRSVPF
FT                   VQANLIKVAGDDPALVAAWRERLQAAGVWANDPVPLYPYPSSPDYRRLWGEPDGRAWER
FT                   AHAHYLAEFDRFSDIQDERPAPLTELESACCPA"
     gtgagaatat ccctcgttaa tccgacctgg accttcacgc agagcatcta tttcggctgc        60
     cgggaacccc acctgccgat cgagctcggg gcctgcaagg tgctgttgga agcggccggg       120
     catgatgtgc tgatgctcga cggagccctg gacgggctct cgctcgagga gctggcggac       180
     cgcgtggcgg atttccgccc cgccatgacc gtggtgacga cggcgccgac ctacctgttc       240
     tggcgctgcg cgcagccgga gctgcgggtt ccgcgggcct tcctcgacgc gctcggggag       300
     cgcgggggca ggaccgtcgt ggtcggcccg cacggctcgg tgacgcccga gacggcgctc       360
     accaagctcg gctgcgactt cgtggtccgg ggcgaatgcg aggaggtcgt cgcggctttg       420
     gcctcgggcg gcctggagcg gccggatcgc gtgcccgccc tggcctaccg ggacggcctg       480
     gagatcaccg tcacgggcgg accggccgcg gcgcgcttcg ccgatctccc ggccctctcc       540
     tggccggagg cgtggatcgc ccgccaccat catcatcacc accgcttcga ccgcgcgccg       600
     gacgggccgg gtgcggaagt ggaggcgtcg cggggctgcc cctatacctg caccttctgc       660
     gccaagatcg atttccgcga caagtaccgg cgccgcgacc tcaccatcat cctggaggag       720
     atcgaccgcc tgatcgcgca gggcgtgacc tacctctact tcatcgacga gatcttcctg       780
     ccgcagaagc cgctcctcga agcgctcgtc ggccgagcgg tgtcgttcgg ggtgcagacc       840
     cgcatcgacc tgtggaagcc cgacatgctc gacctcctgg gcgcggcggg ctgcgtctcc       900
     atcgaggcgg gggtggagag cctgaccgag gagggccggg ccctgctcga caagaactgc       960
     cgcgtgtcga cggacgacct cgccgagcgc ctgatccacg cccggcgctc ggtgcccttc      1020
     gtgcaggcga acctgatcaa ggtcgcgggc gacgaccccg ccctggtggc ggcgtggcgc      1080
     gagcgcctgc aggccgccgg cgtctgggcc aacgacccgg tacccctcta tccctacccc      1140
     tcctcgccgg attaccgccg cctctggggc gagccggacg gccgcgcctg ggagcgggcg      1200
     catgcccatt acctcgccga gttcgaccgc ttcagcgaca tccaggacga gcggccggcc      1260
     ccgttgaccg aactggaatc cgcatgctgc ccggcctga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page