(data stored in ACNUC7421 zone)

EMBL: CP001349.PE425

CP001349.PE425       Location/Qualifiers
FT   CDS_pept        491286..492446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0435"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   met:M446_2075 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55477"
FT                   /db_xref="GOA:B8IC89"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC89"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACL55477.1"
FT                   /translation="MLPGLTAARPRAPSLNLFMTADAVGGVWQYALDLCLDLERRGLGI
FT                   TLAVLGPEPSVDQLRAARAIRGLDLRVMDVPLDWTALTRSEVETAAWRVAREAERAGAD
FT                   LVHLNSPALAAIALFPVPIVAVAHSCVATWWASMRGGPLPPDLAWRAALAGEGYRRAAA
FT                   VLSPTRAFAEATAATYALPALPWVVPNGRRSPAERGHRTPRGAAASPFAFTAGRLWDEG
FT                   KNAATLDRVAARLAPRPFLAAGPLDGPNAACFAPRHLRCLGRLTDQDMARWLAGAPIYV
FT                   SAARYEPFGLGVLEAASAACALVLSDIPTFRELWDDAAIFIDPDDDAGFAAAIELVAGD
FT                   PAIRARLGAEAKVRADALTVEAMGAGVLAAYQAVLGETPRRAGAPA"
     atgctgcccg gcctgaccgc cgcgcgcccg cgcgctccct ccctcaacct gttcatgacc        60
     gcggatgcgg tcggcggcgt ctggcaatac gccctcgacc tctgcctcga cctcgagcgc       120
     cgcggcctcg gcatcaccct cgcggtgctg gggcctgagc cgagcgtcga ccagctgcgc       180
     gccgcgcgtg ccatccgggg gctcgacctg cgggtgatgg acgtgcccct cgactggacg       240
     gcgctcaccc gcagcgaggt cgagaccgcc gcctggcggg tcgcccgcga ggccgagcgg       300
     gccggcgccg atctcgtcca tctcaacagc ccggcgctcg cggccatcgc gctgttcccg       360
     gttccgattg tggcggtggc gcattcctgc gtcgccactt ggtgggcttc catgcgcggc       420
     gggccgctgc cgcccgacct cgcctggcgg gccgcccttg ccggcgaggg ctaccgacgg       480
     gccgccgcgg tgctgagccc tacccgcgcc ttcgcggagg cgaccgccgc cacctacgcg       540
     ctcccggccc tgccctgggt cgtgccgaac ggccgtcgca gcccggccga gcgcggccac       600
     cgcacgccgc gcggtgccgc cgcctcgccc ttcgccttca cggccggccg cctctgggac       660
     gagggcaaga acgccgcgac cctcgaccgg gtcgcggccc gcctcgcccc gcgccccttt       720
     ctggccgccg gtccgctcga cggccccaac gccgcctgct tcgccccccg gcatctgcgc       780
     tgcctcgggc ggctgaccga tcaggacatg gcgcgctggc ttgcgggcgc gccgatctac       840
     gtctcggcgg cccgctacga gcccttcggc ctcggcgtgc tggaggccgc gagcgcggcc       900
     tgcgccctcg tcctctcgga tatcccgacc ttccgcgagc tctgggacga cgccgcgatc       960
     ttcatcgatc cggacgacga tgcgggcttt gccgccgcga tcgaactcgt ggcgggagat      1020
     ccggcaatcc gcgcccggct cggcgccgag gcgaaggtgc gggcggacgc cctcacggtc      1080
     gaggcgatgg gggcgggcgt gctcgccgcc tatcaggccg tgctcggcga gacgccccgg      1140
     cgcgccggag cgcccgcgtg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page