(data stored in ACNUC7421 zone)

EMBL: CP001349.PE426

CP001349.PE426       Location/Qualifiers
FT   CDS_pept        492443..493555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55478"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC90"
FT                   /inference="similar to AA sequence:KEGG:M446_2074"
FT                   /protein_id="ACL55478.1"
FT                   /translation="MRIVVFTHSLRSCWNHGNAHFLRGTLRELIALGHDVAVHEPAGAW
FT                   SLANLVADHGEAGAAASLGPYPELSSRIDPPGFDPAEALDGADLVLVHEWNEPALVARI
FT                   GALRKAGGRFTLLFHDTHHRAVSEPAAMRAYDLSGYDGVLAFGETLAAVYRGWGWGSCV
FT                   FVWHEAADTRLFRPPAQETGRAGLVWIGNWGDGERSAELESFLFRPARDAGLSLDVWGV
FT                   RYPDEARAALDRYGARYRGWLPNARAPEVFARHLATIHVPRRFYVEALPGIPTIRVFEA
FT                   LACGIPLVSAPWRDSEGLFTPGRDFLMAGDEAAMGRHLRALRDDPALRAEIAAHGLATI
FT                   RARHTCAHRAAELMAVAERLAGPLSLKAAG"
     gtgaggatcg tcgtcttcac gcattccctg cgctcgtgct ggaaccatgg caacgcgcat        60
     tttctgcgcg gcaccctgcg cgagttgatc gcgctcggcc acgacgtagc ggtgcacgag       120
     cccgcgggcg cctggagcct cgccaatctc gtcgccgatc acggcgaggc cggcgcggcc       180
     gcctcgctcg ggccctatcc ggagctgtcc tcgcggatcg acccaccggg cttcgacccg       240
     gcggaggccc tcgacggggc ggatctcgtc ctcgtccacg agtggaacga gccggccctc       300
     gtcgcccgca tcggcgcgct ccgcaaggcg ggcggacgct tcacgctcct gttccacgac       360
     acgcatcatc gggcggtgag cgagcccgcc gccatgcggg cctacgacct ctcgggctat       420
     gacggcgtgc tggccttcgg ggagacgctg gccgccgtct atcgcggctg gggctggggc       480
     agctgcgtct tcgtctggca cgaggccgcc gacaccaggc tgttccgccc gccggcgcag       540
     gagacgggcc gcgccggcct ggtctggatc ggcaactggg gcgacggcga gcgcagcgcc       600
     gagctcgaat ccttcctgtt ccgcccggcc cgcgatgccg gcctgtccct cgacgtctgg       660
     ggcgtgcgct atcccgacga ggcccgcgcc gccctcgacc gctatggcgc ccgctatcgc       720
     ggctggctgc cgaatgcccg cgcgccggag gtcttcgccc ggcatctcgc cacgatccat       780
     gtgccgcggc gcttctacgt cgaggcgctg cccggcatcc cgacgatccg ggtgttcgag       840
     gcgctggcct gcggcatccc tctcgtctcg gcgccctggc gcgacagcga gggcctgttc       900
     acgcccggcc gcgacttcct gatggccggg gacgaggccg cgatgggccg gcatctgcgg       960
     gccctgcgcg acgatcctgc gcttcgcgcg gagatcgccg ctcacggcct cgcgacgatt      1020
     cgcgcccgcc atacctgcgc ccaccgggcc gcggaactca tggcggtggc ggagcgtctc      1080
     gcgggaccac taagcctgaa ggcagccgga tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page