(data stored in ACNUC7421 zone)

EMBL: CP001349.PE427

CP001349.PE427       Location/Qualifiers
FT   CDS_pept        493641..494738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55479"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC91"
FT                   /inference="similar to AA sequence:KEGG:M446_2073"
FT                   /protein_id="ACL55479.1"
FT                   /translation="MSTIAFYGSSLLSSYWNGAATYYRGLIRDLARRGWRTTFYEPDAF
FT                   DRQRHRDIDPPDWASVTVYPATEEAARAVIAQAARADVVVKASGVGVFDDLLLAGVTAA
FT                   ARPDAVRLFWDVDAPATLAELRTAPDHPLRRTLPALDLVLTYGGGPPVVEAYEEFGARR
FT                   CVPVYNALDPDTHHPVPADPRFAADLSFLGNRLPDREARVDEFFLRPAERLPDRAFLIG
FT                   GNGWDSRALPANVRHIGHVSTRDHNAFNVTPRAVLNIARDSMAATGWSPATRVFEAAGA
FT                   GACLITDAWVGLDMFLKADEEVLVARDGADVAEHVAALTPQRAASIGAAGRRRILAEHT
FT                   YARRGAEVDAILRAALASRRARSVA"
     atgagcacca tcgccttcta cggctccagc ctcctctcct cctactggaa cggtgcggcc        60
     acctactacc gcggcctgat ccgcgacctc gcgcggcggg gctggcggac gaccttctac       120
     gagcccgacg ccttcgaccg gcagcggcac cgggacatcg acccgccgga ctgggcctcc       180
     gtcacggtct atccggcgac cgaggaggcc gcgcgggcgg tgattgcgca ggccgcccgg       240
     gcggacgtgg tggtgaaggc ctccggcgtc ggcgtgttcg acgacctgct gctcgcgggc       300
     gtgaccgcgg cggcccggcc cgatgccgtg cggctgttct gggacgtcga tgcccccgca       360
     accctggccg agctgcggac cgcgcccgat catccgctgc gccgcaccct ccccgccctc       420
     gacctcgtcc tgacctatgg cggcgggccg ccggtggtgg aggcctacga ggagttcggc       480
     gcgcgccgct gcgtcccggt ctacaacgcc ctcgacccgg acacccacca tcccgtgccg       540
     gcggacccgc gcttcgccgc cgatctctcc ttcctcggca accgcctgcc ggaccgggag       600
     gcccgggtcg acgagttctt cctgcggccc gccgagcgcc tgccggaccg ggccttcctg       660
     atcggcggca acggctggga ttcgcgggcg ctgcctgcca atgtccgcca catcggccac       720
     gtctcgaccc gcgaccacaa cgccttcaac gtgacgcccc gggcggtgct gaacatcgcc       780
     cgggactcga tggcggcgac gggctggtcg ccggccaccc gggtgttcga ggccgcgggc       840
     gccggggcct gcctcatcac cgacgcctgg gtcggcctcg acatgttcct caaggccgac       900
     gaggaggtgc tggtcgcccg cgacggcgcg gacgtggccg agcacgtcgc cgcattgacc       960
     ccgcagcgcg ccgcctccat cggcgcggcg ggccgccggc gcatcctcgc ggagcacacc      1020
     tatgcgcggc gcggcgctga ggtcgacgcc atcctgcggg cggcgctcgc ttcgaggcgc      1080
     gcgaggagcg tcgcgtga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page