(data stored in ACNUC7421 zone)

EMBL: CP001349.PE428

CP001349.PE428       Location/Qualifiers
FT   CDS_pept        494735..495883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55480"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC92"
FT                   /inference="similar to AA sequence:KEGG:M446_2072"
FT                   /protein_id="ACL55480.1"
FT                   /translation="MSRPLDLVVLGLSLSSSWGNGHATTYRALLKAFAARGHRVTFLER
FT                   DVPWYAAHRDLADPDYCELILYPDLASLKDLRPRLLRADAAIVGSYVPDGVAVGRWAIA
FT                   AMREAGGVAAFYDIDTPVTLAKLARGDHEYLTPDLIRAYDLYLSFTGGPVLARLEREHG
FT                   SPLARALYCSVDPAHYTPGGAKPSYDLSYLGTYSPDRQPTLERLLIEPARRAPHLRFVV
FT                   AGPQYPADIAWPANVERREHVGPADHPAFYAASRWTLNVTRADMREAGYSPSVRLFEAA
FT                   ACGTPILSDAWPGLDTILTPGREIVAADGPEAVLRALTETPEPDRAALARAARRRVLAA
FT                   HSAAHRATELEAALGEARARAAQKYPQHVWKLGFSERVGERR"
     gtgagccggc ccctcgatct cgtggttctg ggcctcagcc tgtcctcgtc ctggggcaac        60
     ggccatgcca ccacctaccg ggcgctgctg aaggccttcg cggcgcgggg ccaccgggtg       120
     accttcctgg aacgggacgt gccctggtac gcggcgcatc gcgacctcgc cgatccggat       180
     tactgcgagc tgatcctcta tcccgacctc gcttccctca aggacctgcg cccgcggctc       240
     ctgcgggcgg atgcggcgat cgtcggctcc tacgtgccgg acggcgtcgc ggtcggccgc       300
     tgggccatcg cggcgatgcg cgaagccggc ggcgtcgcgg ccttctacga catcgacacg       360
     cccgtcaccc tcgccaagct cgcccgcggc gaccacgaat acctcacccc cgacctgatc       420
     cgcgcctacg acctctatct ctccttcacg ggcgggccgg tgctggcgcg cctggagcgg       480
     gagcacggct caccgctcgc gcgagcgctc tactgctccg tcgacccggc gcattacacc       540
     ccgggcggcg ccaagccttc ctatgatctc tcgtatctcg gcacctacag cccggaccgg       600
     cagccgaccc tggagcggct gctgatcgag cccgcccggc gggcgcccca cctgcgcttc       660
     gtggtcgccg ggccgcaata ccccgccgac atcgcctggc cggccaatgt ggagcggcgc       720
     gagcatgtcg gtcccgccga tcatccggcc ttctacgcgg cgagccgctg gaccctcaac       780
     gtcacccgcg ccgacatgcg ggaagcgggc tacagcccga gcgtccgcct gttcgaggcc       840
     gccgcctgcg gcacgccgat cctgtcggat gcctggcccg gcctcgacac gatcctgacg       900
     ccggggcgcg agatcgtggc ggcggacggc ccggaggcgg tgctgcgtgc cctgaccgag       960
     acccccgaac ccgaccgtgc ggccctcgcg cgggcggccc gccgccgcgt gctcgccgcc      1020
     cacagtgccg cgcatcgggc gacggaactc gaagcggcgc tcggcgaggc ccgcgccagg      1080
     gccgcgcaga aatacccaca gcatgtatgg aaactcggct tcagcgagcg cgttggggag      1140
     cgaaggtaa                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page