(data stored in ACNUC7421 zone)

EMBL: CP001349.PE429

CP001349.PE429       Location/Qualifiers
FT   CDS_pept        495942..496964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0439"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: met:M446_2071 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55481"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC93"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55481.1"
FT                   /translation="MTNRKSPTVLVAGGAGFLGSHLCEALLARGDRVICLDNFLTGRRR
FT                   NLRHLEREPRFELIEHDVVRPLPASLRRRPFERIYNLACAASPPHYQADPEHTLLTSVL
FT                   GARHLLMLAEAAGASLLQASTSEIYGDPEVHPQAEAYWGHVNPTGPRACYDEGKRAAET
FT                   LCYDYARAGRVAVRVARIFNTYGPRMRADDGRVVSNVVCQALAGDDITVYGDGSQTRSF
FT                   CYVADLIDGLVRLMAHEAPGFAVPPVNLGNPVELTVSDLVQRVLAMTGSPSAIVTRPLP
FT                   TDDPRRRRPDIARAQELLGWAPKVPLDQGLKATILWFADEAEDGPRGVVVPEERRAVLV
FT                   "
     atgacgaatc gcaagagccc gaccgttctc gtcgccggcg gcgcggggtt cctgggttcc        60
     cacctctgcg aggcgctgct ggcccggggt gaccgggtga tctgcctcga caacttcctc       120
     accggacgcc gccgcaacct gcgccacctc gaacgcgagc cgcgcttcga gctcatcgag       180
     cacgacgtcg tgcggcccct gcccgcctcc ctgcgccgcc gccctttcga gcgcatctac       240
     aatctcgcct gcgcggcctc tccgccgcat taccaggccg atccggagca cacgctcctc       300
     accagcgtgc tcggcgcgcg ccacctgctg atgctggcgg aagccgcggg cgcgagcttg       360
     ctgcaggcct cgacctcgga gatctacggc gatccggagg tgcatcccca agccgaagcc       420
     tattggggcc atgtcaatcc gaccgggccg cgcgcctgct acgacgaggg caagcgggcg       480
     gccgagacgc tgtgctacga ctatgcccgg gccggccgcg tcgcggtgcg ggtggcgcgc       540
     atcttcaaca cctacgggcc gcgcatgcgg gccgatgacg gccgggtcgt gtcgaacgtg       600
     gtctgccagg cgctggcggg cgacgacatc acggtctacg gcgacggctc gcagacccgg       660
     tccttctgct acgtggccga cctgatcgac ggcctcgtgc ggctgatggc gcatgaggcg       720
     ccgggcttcg ccgttccgcc cgtcaatctc ggcaacccgg tggagctcac cgtctcggat       780
     ctggtgcagc gggtgctcgc gatgacgggc tcgccctcgg cgatcgtgac ccggccgctc       840
     ccgaccgacg acccgcgccg ccgccggccg gatatcgcgc gggctcagga gctgctcggc       900
     tgggccccga aggtcccgct ggaccagggg ctcaaggcca cgatcctgtg gttcgccgac       960
     gaggccgagg acggcccgcg aggcgtcgtc gtgccggagg agcgccgggc ggtcctggtc      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page