(data stored in ACNUC7421 zone)

EMBL: CP001349.PE43

CP001349.PE43        Location/Qualifiers
FT   CDS_pept        complement(47783..49618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0044"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region
FT                   ATPase domain protein; KEGG: met:M446_0044 heat shock
FT                   protein HSP90"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55095"
FT                   /db_xref="GOA:B8IU50"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IU50"
FT                   /inference="protein motif:PFAM:PF00183"
FT                   /protein_id="ACL55095.1"
FT                   /translation="MSETLERHAFGAEVGRLLDLVVHALYSEREIFLRELVANAADAVD
FT                   RRRFGALTDPALALPAEAKVRIRPDKAARTLTISDPGIGMGKEDLAQNLGTIARSGTRA
FT                   FSQSLAEAKPDERPSLIGQFGVGFYSAFMVADRVEVTSRRAGSDEAWTWASDGEGEYTL
FT                   SPATREEPGTDVVLHMKADADEYLEPLRIETIVRKWADHITVPITLLRDGEEVSGNEGT
FT                   ALWRKPKAEITEETYTAFYRHLTHNFDTPWATLHWRAEGALDFSALLFIPSMKPFLAVE
FT                   EERESKVRLHVRRMFITDEAGLLPSWLRFVQGVVDTEDLPLNVSREMLQATPVLARIRR
FT                   AVTAKVLSELKSRAKDADGYASFWQAFGPVLKEGIWEDAEQRDDIAGLIRFRSSAVEGW
FT                   TSFADYVSRMKPNQEAIYILVGDDTKALASSAQIEGFRARGIEVLLLSDHVDAFWPERL
FT                   DKFDGKPIRSITQSADDLSAFAPEGESEGEAADLADLVPKLKEILKDDVTDVRASQRLV
FT                   ESAVLLSASSGGPDLQMQRLLRRAGRGFGAGLPVLELNPRHALVRRLAERAKTGEDIAE
FT                   AAQTLLDLAHVQGGDAPRDPVAFARRVATALAAQG"
     gtgagcgaga ctctggaacg gcatgccttc ggggccgagg tcgggcgcct cctggatctc        60
     gtcgtccacg cgctctattc cgagcgcgag atctttctgc gggaactcgt cgccaatgcg       120
     gccgacgcgg tcgatcggcg ccgcttcggg gcgctcaccg accccgccct cgctctgccg       180
     gccgaggcca aggttcgcat ccggcccgac aaggccgcgc gcaccctgac catctcggat       240
     ccgggcatcg gcatgggcaa ggaggatctg gcgcagaacc tcggcaccat cgcgcgctcg       300
     ggcacccgcg ccttcagcca gtcgctcgcc gaggccaagc ccgacgagcg gccgagcctc       360
     atcggccagt tcggcgtcgg cttctactcg gccttcatgg tggccgaccg ggtcgaggtg       420
     acctcgcggc gcgccggatc cgacgaggcc tggacctggg cctcggacgg ggagggggag       480
     tacacgctct cgcccgcgac ccgggaggag cccggcaccg acgtcgtgct tcacatgaag       540
     gccgatgccg acgagtatct ggagcccctg cgcatcgaga ccatcgtgcg caaatgggcc       600
     gaccacatca ccgtgccgat cacgctcctg cgcgacggcg aggaggtttc cggcaacgag       660
     ggcaccgcgc tctggcgcaa gcccaaggcg gagatcaccg aggagaccta cacggccttc       720
     taccgccacc tcacccacaa cttcgacacg ccgtgggcga cgctgcactg gcgggcggag       780
     ggcgccctgg acttctcggc gctgctcttc atcccgagca tgaagccctt cctcgccgtc       840
     gaggaggagc gcgagagcaa ggtgcggctg catgtgcgcc gcatgttcat caccgacgag       900
     gccgggctgc tgccctcctg gctgcgcttc gtgcagggcg tcgtcgacac cgaggatctg       960
     ccgctcaacg tctcgcgcga gatgctgcag gcgacgccgg tgctcgcccg catccgccgc      1020
     gcggtgacgg ccaaggtcct ctcggagctg aagtcccgcg ccaaggatgc ggatggctat      1080
     gccagcttct ggcaggcttt cgggccggtg ctgaaggagg gcatctggga ggatgccgag      1140
     cagcgcgacg acatcgcggg cctcatccgc ttccgctcct cggccgtgga gggctggacc      1200
     tccttcgccg actacgtctc gcggatgaag ccgaaccagg aggcgatcta catcctggtc      1260
     ggcgacgaca ccaaggcgct ggcctcctcc gcccagatcg aggggtttcg agcccgcggc      1320
     atcgaggtgc tgctcctctc cgaccacgtg gacgccttct ggcccgagcg cctcgacaag      1380
     ttcgacggca agccgatccg cagcatcacg cagagcgcgg acgatctctc ggccttcgcg      1440
     ccggagggtg agtcggaggg cgaggcggcg gacctcgccg acctcgtgcc gaagctcaag      1500
     gagatcctga aggacgacgt gaccgacgtg cgcgcgagcc agcgcctcgt cgagagcgcc      1560
     gtcctgctct ccgcctcctc gggcgggccg gatctccaga tgcagcgcct tctgcgccgg      1620
     gccggccgcg gcttcggggc gggcctgccg gtgctggagc tcaatccgcg ccacgcgctg      1680
     gtccgccgcc tcgccgagcg ggcgaagacc ggcgaggaca tcgcggaggc ggcgcagacg      1740
     ctcctcgacc tcgcccatgt tcagggcggg gatgcgcccc gcgacccggt cgccttcgcg      1800
     cgccgcgtgg ccacggcgct cgccgcgcaa ggatag                                1836
//

If you have problems or comments...

PBIL Back to PBIL home page