(data stored in ACNUC7421 zone)

EMBL: CP001349.PE430

CP001349.PE430       Location/Qualifiers
FT   CDS_pept        complement(497106..497282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0440"
FT                   /product="metallothionein family 14"
FT                   /note="PFAM: metallothionein family 14; KEGG: met:M446_2070
FT                   metallothionein family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55482"
FT                   /db_xref="GOA:B8IC94"
FT                   /db_xref="InterPro:IPR000518"
FT                   /db_xref="InterPro:IPR017854"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC94"
FT                   /inference="protein motif:PFAM:PF02069"
FT                   /protein_id="ACL55482.1"
FT                   /translation="MSDPVKVEMVKCACQDCVCVVPLAKAVQRDGRAYCCDECAAGHPD
FT                   HAGCDHAGCTCHG"
     atgagtgatc cggtcaaggt cgagatggtc aagtgtgcct gtcaggattg cgtctgcgtc        60
     gttccgctcg ccaaggcggt gcagcgcgat gggcgggcct attgctgcga cgaatgtgcc       120
     gccgggcatc cggaccacgc cgggtgcgat cacgccggct gcacctgcca cggttga          177
//

If you have problems or comments...

PBIL Back to PBIL home page