(data stored in ACNUC7421 zone)

EMBL: CP001349.PE431

CP001349.PE431       Location/Qualifiers
FT   CDS_pept        complement(497728..498585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0441"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: met:M446_2069 LmbE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55483"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC95"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ACL55483.1"
FT                   /translation="MSAVVTGPLAPTSPEAEAFLTALAHPARGPVRAGHAALVVAHPDD
FT                   ESIGCGAQLPRLAGLAVIHVTDGAPRSGPDAARHGFADPTAYAAARARELDAALTLARV
FT                   PPERRLALGLPDQGVAEALAALARRLAEIFAARGITLALTHAYEGGHPDHDAVALAVQG
FT                   AKRLMGGALAVIEMPYYHRGAQGPEAGAFLPTQPPRRAIALHLDPEDCALKADLFAAHA
FT                   TQAAILNRLPIALERFREAPAYRFDTLPNEGRLLYEEWQLGLNGARFLDLARAAEREIA
FT                   GLCP"
     atgagcgccg tcgtcaccgg gccgctggcg ccgacctctc cggaggcgga ggccttcctc        60
     acggcgctgg cgcatccggc ccgcggcccc gtgagggccg gccacgcggc gctcgtcgtg       120
     gcgcatcccg acgacgagag catcggctgc ggcgcgcagc tgccgcggct cgccggcctc       180
     gcggtcatcc acgtcaccga cggtgcgccg cgcagtgggc cggatgccgc gcgccacggt       240
     ttcgcggatc cgaccgccta cgcggccgcc cgtgcccggg aactcgatgc ggcgctgacg       300
     ctcgcgcgcg tgccgcccga gcggcgcctc gccctcggcc tgccggatca gggcgtcgcg       360
     gaggcgctgg cggcgctcgc ccggcgcctc gccgagatct tcgcggcgcg cggcatcacg       420
     ctcgcgctca cccatgccta cgagggcggc cacccggacc acgacgcggt ggcgctggcc       480
     gtgcaggggg cgaagcggct gatgggcgga gccctcgcgg tgatcgagat gccctattac       540
     catcgcggcg cgcaggggcc ggaggccggc gccttcctgc cgacacagcc gccgcggcgg       600
     gccatcgcgc tccacctcga tccggaggat tgcgccctca aggccgacct gttcgccgcg       660
     catgcgacgc aagccgcgat cctcaaccgc ctgccgatcg ccctcgaacg gttccgcgag       720
     gcgccggcct accgcttcga taccctgccg aacgagggac ggctcctcta cgaggagtgg       780
     cagctggggc tgaacggggc ccgcttcctc gacctcgcgc gggcggcgga gcgggagatc       840
     gccggacttt gtccttga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page