(data stored in ACNUC7421 zone)

EMBL: CP001349.PE432

CP001349.PE432       Location/Qualifiers
FT   CDS_pept        complement(498582..499517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55484"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024655"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC96"
FT                   /inference="similar to AA sequence:KEGG:M446_2068"
FT                   /protein_id="ACL55484.1"
FT                   /translation="MIEAAMIWNEPNNKSHWDPEIDPGWHLFADTLACAAQALKQEAPA
FT                   LPTVLGGLSPIDPTFVQFLDSKRALDHVDVVAVHGFPLDWNLWQINEWPAKLAEIRAVT
FT                   PKPVWVTEVGVSTFGAEEVQVFGLERTAALLIGRTPRIHWYSLYDLPQAWGATTRHKEA
FT                   EGSSYYRHFYMGLLREDGTPKPALEQFGRYAPAMGLCQWFHFEDHRLDDAVAWMRRLGV
FT                   RYLRTGLSWADSFRPNALDWFDRQMEALAEFDVTVTFCFTPEHRGIAPHHTSPPQVKEE
FT                   FAEFCTAMIRRYAGQLRPRSDALAMPASLA"
     atgatcgaag cggcgatgat ctggaacgag cccaacaaca agtcgcattg ggatcccgag        60
     atcgatccgg gctggcacct cttcgccgac acgctcgcct gcgcggcgca ggccctcaag       120
     caggaggcgc ccgcgctgcc caccgtgctg ggcggcctct cgcccatcga tccgaccttc       180
     gtgcagttcc tcgattcgaa gcgcgccctc gaccatgtcg acgtcgtggc ggtgcatggg       240
     ttccccctcg actggaacct ctggcagatc aacgagtggc cggccaagct cgccgagatc       300
     cgcgcggtga cgcccaagcc cgtctgggtg acggaggtgg gcgtgtcgac cttcggggcc       360
     gaagaggtgc aggtcttcgg ccttgagcgc accgccgcgc tgctgatcgg ccgcacgccg       420
     cgcatccact ggtacagcct ctacgacctg ccgcaggcct ggggcgccac cacccggcac       480
     aaggaggcgg agggctcctc ctactaccgc cacttctaca tggggctcct gcgcgaggac       540
     gggacgccga agcccgcact cgagcagttc ggccgctacg cccccgcgat ggggctgtgc       600
     cagtggttcc atttcgagga ccatcgcctc gacgacgctg tcgcctggat gcggcggctc       660
     ggcgtgcgct acctgcgcac cggcctctcc tgggccgatt ccttccggcc gaacgccctc       720
     gactggttcg accggcagat ggaggcgctc gccgagttcg acgtcacggt caccttctgc       780
     ttcacgcccg aacaccgggg catcgcgccc caccacacca gcccgcccca ggtgaaggag       840
     gaattcgcgg agttctgcac cgccatgatc cggcgctatg ccggccagct tcgcccgcgg       900
     tcggacgccc tcgcgatgcc ggcttccctc gcatga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page