(data stored in ACNUC7421 zone)

EMBL: CP001349.PE433

CP001349.PE433       Location/Qualifiers
FT   CDS_pept        499683..500642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0443"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mpo:Mpop_2285
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55485"
FT                   /db_xref="GOA:B8IC97"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC97"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACL55485.1"
FT                   /translation="MQLTGIHHLTAVTAQAADNFAFYTRVLGQRLVKKTVNQDDVSAFH
FT                   LFYGDGVASPGSDLTFFDWPAPRERRGTNSIARTLLRVAGPEAIAWWREHLGRQGVSHR
FT                   LPVERDGRLTLDFEDPEGQRLGLVDDGGAGEAHPWAGSPVPAEHQIRGLGPILLSVADP
FT                   AATEAVLTGVLGMRPMREYPAGDAAAERSAERPVRVYAMGAGGPAAELHVVAEPDLGPA
FT                   RPGAGGVHHVAFRIPDAAYEAWADRLRTLRVPSSGPVDRYYFRSLYFREPNGILFEIAT
FT                   DGPGFATDEPLDRLGERLALPPFLEPRRAQIEAGLKPL"
     atgcagctca ccggaatcca ccacctcacc gccgtcacgg cgcaggccgc cgacaatttc        60
     gccttctaca cccgcgtgct cggccagcgc ctcgtgaaga agaccgtcaa ccaggacgac       120
     gtctcggcct ttcacctgtt ctatggcgac ggtgtcgcct cgccgggctc ggacctgacc       180
     ttcttcgact ggccggcccc gcgcgagcgg cgcggcacga acagcatcgc ccgcaccctg       240
     ctgcgggtgg ccggccccga ggccatcgcg tggtggcgcg agcatctcgg ccgccagggg       300
     gtcagccacc gcctgccggt ggagcgcgac gggcggctca ccctcgactt cgaggatccg       360
     gagggccagc ggctcggcct cgtggacgat ggcggcgccg gcgaggccca tccctgggcc       420
     ggcagcccgg tgccggccga gcaccagatc cgcgggctcg ggccgatcct gctcagcgtc       480
     gccgacccgg ccgcaacgga ggcggtgctc accggcgtgc tcgggatgcg gccgatgcgc       540
     gagtacccgg ccggcgacgc ggcggccgag cgctcggcgg agcggccggt gcgggtctac       600
     gcgatggggg cgggcggccc ggcggcggag ctgcacgtgg tggccgagcc cgatctcggc       660
     ccggcccggc ccggggccgg cggcgtccat cacgtggcct tccgcatccc cgatgcggcg       720
     tacgaggcct gggccgaccg gctgcggacc ctgcgggtgc cgtcgagcgg cccggtcgac       780
     cgctactact tccgcagcct ctacttccgg gagccgaacg ggatcctgtt cgagatcgcg       840
     accgacggcc cgggcttcgc gacggacgag cccctggaca ggctcggcga gcgcctcgcg       900
     ctcccgccct tcctggagcc gcgccgggcg cagatcgagg cggggctgaa gccgctgtaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page