(data stored in ACNUC7421 zone)

EMBL: CP001349.PE434

CP001349.PE434       Location/Qualifiers
FT   CDS_pept        complement(500753..501379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0444"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /note="TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase; KEGG: met:M446_2067
FT                   phosphoglycerate mutase 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55486"
FT                   /db_xref="GOA:B8IC98"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC98"
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /protein_id="ACL55486.1"
FT                   /translation="MERLLVLARHGQSEWNLKNLFTGWRDPDLTEIGVAEARAAGRRLK
FT                   AKGIRFDVAFTSALTRAQRTAELILEELGQPDLPTIADAALNERDYGDLSGLNKDDARE
FT                   RWGKEQVHVWRRSYDVPPPGGESLKDTVARVLPYTMREILPRVMRGERVLVAAHGNSLR
FT                   ALVMVLDGLTTETIPGLELWTGVPLVYHLKADTTVESKEVLDKDV"
     atggagcgcc ttctcgtcct cgcgcggcac ggccagagcg agtggaacct gaaaaatctc        60
     ttcaccggct ggcgcgatcc ggacctcacc gaaatcggcg tcgccgaggc gcgggcggcg       120
     ggccggcggc tgaaggcgaa gggcatccgg ttcgacgtcg ccttcacctc ggccctgacc       180
     cgggcccagc gcacggccga gctgatcctg gaggagctcg gccagccgga cctgccgacc       240
     atcgccgacg cggcgctgaa cgagcgcgat tacggcgacc tctcgggcct caacaaggac       300
     gacgcccgtg agcgctgggg caaggagcag gtccatgtct ggcgccgctc ctacgacgtg       360
     cccccgcccg gcggcgagag cctgaaggac acggtcgccc gcgtgctgcc ctacacgatg       420
     cgcgagatac tgccgcgcgt gatgcgcggc gagcgggtgc tggtggcggc ccacggcaac       480
     tccctgcgtg ccctcgtcat ggtgctcgac gggctcacca ccgagacgat cccgggcctg       540
     gagctgtgga ccggcgtgcc gctggtctac catctgaagg ccgacaccac ggtcgagagc       600
     aaggaagtcc tcgacaagga cgtgtag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page