(data stored in ACNUC7421 zone)

EMBL: CP001349.PE435

CP001349.PE435       Location/Qualifiers
FT   CDS_pept        complement(501411..502208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0445"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   met:M446_2066 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55487"
FT                   /db_xref="GOA:B8IC99"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC99"
FT                   /inference="protein motif:PFAM:PF01113"
FT                   /protein_id="ACL55487.1"
FT                   /translation="MRLVVVGASGRMGRMLIQTVVGTEGCTLAGAVAREGSAAIGEDAG
FT                   VLAGLPPLGLAVTDDPLRAFAEADGVLDFTAPATTVFYAELAAQARLVHVVGTTGLSAD
FT                   DLKKLDAASRHARIVRSGNMSLGVNLLAGLVRKVAATLGEEFDIEILEMHHRHKVDAPS
FT                   GTALLLGKAAAEGRAVALAERKVAVRDGHTGARVPGTIGFATLRGGSVVGEHSVIFAGA
FT                   GERIELTHRAEDRGIFARGAVRAALWAFPQKPGLYDMDDVLGL"
     atgcgtctcg tggtggtggg cgcctccggg cgcatgggcc ggatgctgat ccagacggtc        60
     gtcggcactg agggttgcac attggcgggg gcggttgcgc gtgagggctc ggccgcgatc       120
     ggcgaggatg cgggcgtgct cgccggcctg ccgccgctcg gccttgccgt cacggacgac       180
     ccgctgcggg ctttcgcgga ggccgacggc gtcctcgatt tcacggcgcc ggccaccacg       240
     gttttttacg ccgaactcgc cgcgcaggcc cgcctcgtcc acgtggtcgg cacgaccggc       300
     ctctccgcgg acgacctgaa gaagctcgac gccgcctccc gccacgcgcg catcgtgcgt       360
     tcgggcaaca tgtccctcgg ggtcaacctg ctggcgggcc tcgtgcggaa ggtggcggcg       420
     acgctcggcg aggagttcga catcgagatc ctggagatgc atcaccgcca caaggtcgat       480
     gcgccctccg gcacggcgct cctcctcggg aaggcggcgg ccgagggacg ggccgtggcg       540
     ctcgccgagc gcaaggtggc tgtgcgcgac ggccatacgg gcgcccgcgt ccccggcacg       600
     atcggctttg cgaccctgcg cggcggcagc gtggtcggcg agcacagcgt gatcttcgcc       660
     ggggccggcg agcggatcga gctcacccac cgggccgagg atcgcgggat cttcgcgcgc       720
     ggggcggtca gggccgcgct gtgggccttc ccgcagaagc ccggcctcta cgacatggac       780
     gacgtcctgg gactctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page