(data stored in ACNUC7421 zone)

EMBL: CP001349.PE436

CP001349.PE436       Location/Qualifiers
FT   CDS_pept        complement(502345..503052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0446"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: met:M446_2065 multiple antibiotic resistance
FT                   (MarC)-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55488"
FT                   /db_xref="GOA:B8ICA0"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA0"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ACL55488.1"
FT                   /translation="MPAIESALQSFLLALPALFSIINPLGGALIFAEVTGRRTHEERVL
FT                   LARRIGIYAAAVMLVSLWLGATLLSFFGISLAALRIAGGLVVAAQAWRLLAVPEEREAR
FT                   KAADAASAKTRDREVGVESGGLDEIAFFPLTLPFTTGPGTISVIIALAASRPEAGAARW
FT                   GFLLGATLAVLVIAASVRIAYASADRVVKRIGHARARVLGRLSAFLLLCIGTQITLTGV
FT                   SDVLEPLLAARGR"
     atgcccgcca tcgaatccgc cctgcagagc ttcctgctcg cgcttcccgc cctgttctcg        60
     atcatcaacc cgctcggagg ggcgctgatc ttcgccgagg tcacgggccg ccgcacccat       120
     gaggaacggg tgctgctcgc gcgccgcatc ggcatctacg cggcggcggt gatgctggtc       180
     tcgctctggc tgggcgccac gctcctcagc ttcttcggca tctcgctcgc ggcgcttcgc       240
     atcgcgggcg ggctcgtggt ggcggcccag gcctggcggc tgctcgccgt gccggaggag       300
     cgcgaggccc gcaaggcggc cgacgccgcg tccgccaaga cgcgcgaccg ggaagtgggc       360
     gtggaatccg gcgggctcga cgagatcgcc ttcttcccgc tgaccctgcc cttcacgacg       420
     gggcccggca cgatctcggt catcatcgcg ctcgcggcga gccggccgga ggcgggcgcg       480
     gcccgctggg gcttcctgct cggcgccacg ctggcggtgc tggtgatcgc ggcctcggtg       540
     cgcatcgcct atgcgtcggc cgaccgggtg gtgaagcgca tcggccatgc ccgggcccgg       600
     gtgctcgggc gcctctcggc cttcctgctc ctctgcatcg gcacccagat caccctcacg       660
     ggggtgagcg atgtgctcga acccctgctc gcggcccggg ggcgctga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page