(data stored in ACNUC7421 zone)

EMBL: CP001349.PE437

CP001349.PE437       Location/Qualifiers
FT   CDS_pept        complement(503060..503800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0447"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: met:M446_2064
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55489"
FT                   /db_xref="GOA:B8ICA1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL55489.1"
FT                   /translation="MSVDVTDLRAFYSGPLGAVTQRLVGRTVHRFLGSVAGLRVLGLGY
FT                   AVPYLGPVRHAAERTLAFMPAMQGVVNWPATGRSASALVDPTMMPLPEAAVDRVILVHA
FT                   IEAVESPAELLQEVWRVLTPGGRLVLVVPNRRGLWARRDATPFGHGQPYSRSQLGRLMR
FT                   ETLFSPEGWAETLYVPPVEGWITLRTASAWERVGTSLSLPFAGLHVVDAIKQLHRPVTV
FT                   QARRAARLRAPVLVPAPAPVPGGV"
     atgagcgtcg acgtcaccga tcttcgcgcc ttctacagcg ggcctctcgg cgccgtgacg        60
     cagcgccttg tcggccgcac ggtgcaccgg ttcctcggct ccgtcgccgg cctgcgggtg       120
     ctcggcctcg gctacgcggt gccgtatctc gggccggtgc ggcacgcagc ggagcgcacg       180
     ctcgccttca tgccagccat gcagggggtg gtgaactggc cggccaccgg tcgctcggcc       240
     tcggccctgg tcgatccgac catgatgccc ctgccggagg cggcggtgga ccgggtgatc       300
     ctggtgcatg ccatcgaggc agtggagagc cccgccgagt tgctgcagga ggtctggcgc       360
     gtgctcaccc cgggcggacg gctggtgctg gtggtgccca accgccgcgg cctctgggcg       420
     cggcgcgacg ccacgccctt cgggcacggt cagccctaca gccgctcgca gctcggccgg       480
     ctgatgcgcg agacgctgtt ctcgcccgag ggctgggccg agacgctcta cgtgccgccc       540
     gtcgagggct ggatcacgct gcgcaccgcg agcgcctggg agagggtcgg caccagcctg       600
     tcgctgccct tcgccggcct gcacgtggtc gacgcgatca agcagctcca ccggccggtg       660
     accgtgcagg cccgccgcgc ggcgcggctg cgcgcccccg tgctggtgcc ggcgcccgcg       720
     ccggtgccgg gaggcgtctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page