(data stored in ACNUC7421 zone)

EMBL: CP001349.PE438

CP001349.PE438       Location/Qualifiers
FT   CDS_pept        504007..504774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0448"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="TIGRFAM: hydroxyacylglutathione hydrolase; PFAM:
FT                   beta-lactamase domain protein; KEGG: met:M446_2063
FT                   hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55490"
FT                   /db_xref="GOA:B8ICA2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8ICA2"
FT                   /inference="protein motif:TFAM:TIGR03413"
FT                   /protein_id="ACL55490.1"
FT                   /translation="MPEIRTFLCRSDNIGVLLHDPVTSACAAIDVPEAGAVLRALKETG
FT                   WRLTDILVTHRHFDHVEGIPEVKARTGARVTAPAKAGDAVPEVDATVREGDVVKVGSLV
FT                   GTVWETPGHCADHVTYWFERERLAFAGDTLFTLGCGRVMESPPEVLWRSLSRFLALPDE
FT                   TAIYSGHDYVLSNARFALAADPDNSNLKARAELAERVKRDGRFLIPTTLGEEKATNPFL
FT                   RAGEPALARSVDMAPGSDPAAVFAALREWKNRF"
     atgcccgaga tccgcacctt cctgtgccga agcgacaata tcggggtgct gctgcacgac        60
     cccgtcacca gcgcctgcgc ggccatcgac gtgccggagg cgggcgcggt cctgcgtgcc       120
     ctgaaggaga ccggctggag gctcaccgac atcctcgtca cccaccggca cttcgaccac       180
     gtggagggca tcccggaggt gaaggcccgc acgggcgccc gcgtcaccgc gccggccaag       240
     gcgggggatg ccgtgccgga ggtcgacgcc acggtgcgcg agggggacgt ggtcaaggtc       300
     ggctccctcg tcgggacggt ctgggagacg ccgggccact gcgccgatca cgtcacctac       360
     tggttcgagc gcgagcgcct cgccttcgcg ggggacaccc tgttcaccct cggctgcggc       420
     cgcgtgatgg agagcccacc cgaggtgctg tggcgctcgc tcagccgctt cctcgccctg       480
     ccggacgaga ccgcgatcta ttccggccac gactacgtgc tctcgaatgc ccgcttcgcc       540
     ctcgcggccg atccggacaa cagcaacctc aaggcccggg ccgagctcgc cgagcgggtg       600
     aagcgcgacg ggcgcttcct catcccgacg accctcggcg aggagaaggc gacgaatccg       660
     ttcctgcgcg ccggggagcc ggcgctcgcg cgctcggtgg acatggctcc gggctccgat       720
     ccggccgcgg tgttcgcagc cctgcgcgaa tggaagaacc gcttctga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page