(data stored in ACNUC7421 zone)

EMBL: CP001349.PE439

CP001349.PE439       Location/Qualifiers
FT   CDS_pept        504934..505380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0449"
FT                   /product="protein of unknown function DUF985"
FT                   /note="PFAM: protein of unknown function DUF985; KEGG:
FT                   met:M446_2062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55491"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA3"
FT                   /inference="protein motif:PFAM:PF06172"
FT                   /protein_id="ACL55491.1"
FT                   /translation="MTSSPSLTAAEVVRLLDLKPHPEGGHFRETFRDPREIDGRAASTA
FT                   IYYLLDVGETSEWHRVDAAEIWLWHAGAPLVLTVSPNGHDAEARHLGPDLARGQRPQIV
FT                   VPAGHWQTATSLGAWTLVSCTVAPGFRFEGFELAPPNWRPMPRG"
     gtgacctcct cccccagcct caccgccgcc gaggtggtgc gcctcctcga cctgaagccg        60
     catccggagg gcgggcattt tcgcgagact tttcgcgatc cgcgggagat cgatggccgc       120
     gcggcctcga cggcgatcta ctacctgctc gatgtcgggg agacctcgga gtggcaccgg       180
     gtcgatgcgg ccgagatctg gctctggcac gcgggcgcgc ccctcgtcct gaccgtcagc       240
     ccgaacggcc acgacgccga ggcccggcat ctcggcccgg acctcgcccg cggccagcgg       300
     ccccagatcg tcgtcccggc cggccattgg cagacggcga ccagcctcgg cgcctggacg       360
     ctcgtgagct gcacggtggc gcccggcttt cgcttcgagg gcttcgaact cgcaccgccg       420
     aactggcggc cgatgccgcg gggctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page