(data stored in ACNUC7421 zone)

EMBL: CP001349.PE44

CP001349.PE44        Location/Qualifiers
FT   CDS_pept        complement(49702..50373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0045"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: met:M446_0045 exonuclease RNase T
FT                   and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55096"
FT                   /db_xref="GOA:B8IU51"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU51"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ACL55096.1"
FT                   /translation="MWRGLIRRIDRARLTDPRFAFLFAPSPADEAVALDCETTGLDPRR
FT                   DEIVAVAAIRIRGDRILTSESFRATVQSQRPSSPEAIKVHRLLEAEIRQGMPHDVMLPE
FT                   LLRFIGSRPVVGYYTDFDVGMVDKYARRILRIRLPNPRIDVSALYYACKYRDAPDYVKI
FT                   DLSFARIAADLGLPALPQHDAFNDALMTAMMYVQLRDMLERRASIPRTGTEPVESAAFG
FT                   A"
     atgtggcggg gcctgatccg ccggatcgac cgggcgcggc tcacggatcc gcgcttcgcc        60
     ttcctgttcg cgccgagccc tgcggacgaa gccgtcgccc tcgattgcga gacgaccggg       120
     ctcgatccgc gccgggacga gatcgtggcg gtggcggcga tccgtatccg gggcgaccgg       180
     atcctcacga gcgagagctt ccgggccacc gtgcagagcc agcggccctc ctcgccggag       240
     gcgatcaagg tgcaccgcct gctcgaggcc gagatccgcc agggcatgcc ccatgacgtg       300
     atgctgccgg agctgctgcg cttcatcggc agccggcccg tcgtcggcta ctacaccgac       360
     ttcgatgtcg gcatggtcga caaatatgcg cggcgcatcc tgcggatccg gctgccgaac       420
     ccgcgcatcg acgtctcggc cctctattac gcctgcaagt accgggacgc tccggactac       480
     gtgaagatcg acctgagctt cgcgcgcatc gccgcggatc tcgggctgcc ggcgctgccc       540
     cagcacgacg cgttcaacga cgcgctgatg accgcgatga tgtatgtgca gctgcgcgac       600
     atgctggagc gccgggcctc gatcccgcgc acgggcacgg aacccgtcga gagcgccgcc       660
     ttcggcgcct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page