(data stored in ACNUC7421 zone)

EMBL: CP001349.PE440

CP001349.PE440       Location/Qualifiers
FT   CDS_pept        complement(505587..506471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0450"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: met:M446_2060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55492"
FT                   /db_xref="GOA:B8ICA4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL55492.1"
FT                   /translation="MTVRTATLTGSGAILLWSLLALFTAASGAVPPFQLAAMTFLIGGL
FT                   LGCASWIVRPSGVAALRQKPAVWALGLAGLFGYHALYFAALRLAPPAEAGLISYLWPLL
FT                   IVLFSALLPGEGGLRAPHLVGALLGLSGVVTLFLGRGTLSFEAAALPGYLAALACAFLW
FT                   SGYSVLSRRVGAVPTDAVAGFCLATAALSLLCHLAFETTIWPATVSEWAAVAALGLGPV
FT                   GAAFYLWDIGVKRGDIRLLGVGSYAAPVLSTLILVAAGYAPATLSLALACGLIVAGALV
FT                   ATRAGAEKRERVA"
     atgaccgtcc gcaccgccac cctgaccgga tccggggcga tcctgctctg gtcgctcctc        60
     gcgctcttca ccgcggcctc cggcgccgtg ccccctttcc agctcgccgc gatgaccttc       120
     ctgatcggcg gtctcctcgg ctgcgcgagc tggatcgtgc ggccctccgg ggttgcggcc       180
     ctgcgccaga agcctgcggt ctgggccctg gggctcgcgg gtctgttcgg ctaccacgcc       240
     ctctacttcg cggccctgcg ccttgcgccg cccgcggagg ccgggctcat cagctatctg       300
     tggccgctcc tgatcgtgct gttctcggcc ctgctgccgg gggagggggg cctgcgcgcg       360
     ccgcatctcg tcggcgcgct tctcgggctc tccggcgtcg tgacgctttt cctcggccgc       420
     ggcacgctca gcttcgaggc cgccgccctg ccgggctacc tcgcggcgct cgcctgcgcc       480
     ttcctgtggt cgggctactc ggtgctgtcg cggcgggtgg gcgcggtgcc gaccgacgcg       540
     gtggcgggct tctgcctcgc caccgccgcc ctgagcctcc tctgccatct cgccttcgag       600
     accacaatct ggcccgcgac ggtcagcgaa tgggcggcgg tggcggcgct cggcctcggc       660
     ccggtcggtg cggccttcta tctctgggat atcggcgtga agcgcggcga tatccggctc       720
     ctcggcgtcg gctcctacgc cgcaccggtg ctctcgaccc tgatcctggt ggccgccggc       780
     tacgcgcccg caacgctctc gctggccctc gcctgcgggc tcatcgtggc gggggccctg       840
     gtggcgacgc gggcgggcgc agagaagcgc gagcgtgtgg cgtag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page