(data stored in ACNUC7421 zone)

EMBL: CP001349.PE441

CP001349.PE441       Location/Qualifiers
FT   CDS_pept        506554..507201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0451"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: met:M446_2016
FT                   2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55493"
FT                   /db_xref="GOA:B8ICA5"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA5"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ACL55493.1"
FT                   /translation="MIELAPGLVQHPGYLGPAAQAALAAELARVIDEAPPFTPTMPRTA
FT                   KPFSVQMTNCGPLGWVSDRAGYRYQPHHPETGRPWPPIPAALLAAWDDLVGFPHPPEAC
FT                   LVNLYAPGSRMGLHQDRDEAEFAAPVLSLSLGATAIFRYGGLRRGDPTRSIRLRGGDAL
FT                   VIGGASRLIFHGIDRIVAEPPDLLAAPLLPQAVPPGGRLNLTLRRVSAARPA"
     ctgatcgaac tcgctccggg cctcgtccag catccgggct atctcggccc cgccgcgcag        60
     gccgcgctcg cggccgagct cgcccgcgtg atcgacgagg cgcccccctt cacgccgacc       120
     atgccgcgga cggccaagcc cttctcggtg cagatgacca attgcggccc cctcggctgg       180
     gtctccgacc gggccggcta ccgctatcag ccgcatcatc ccgagaccgg ccgcccctgg       240
     ccgccgatcc cggccgcact cctcgccgcc tgggacgacc tcgtcggctt cccgcacccg       300
     cccgaggcct gcctggtcaa tctctacgca cccggatccc gcatgggcct gcaccaggac       360
     cgggacgagg ccgagttcgc ggcccccgtc ctgtccctct cgctcggggc aacggcaatc       420
     ttccgctacg gcggcctgcg ccgcggcgat cccacgcgct cgatccgcct gcgcggcggc       480
     gacgcgctgg tgatcggcgg ggcctcgcgc ctgatctttc acggcatcga ccggatcgtc       540
     gcggaacccc ccgatctcct cgccgccccg ctgctcccgc aggccgtgcc gccgggcggt       600
     cgcctcaacc tcaccctgcg acgtgtgtcc gctgcccgcc ccgcttga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page