(data stored in ACNUC7421 zone)

EMBL: CP001349.PE442

CP001349.PE442       Location/Qualifiers
FT   CDS_pept        507279..508223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55494"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA6"
FT                   /inference="similar to AA sequence:KEGG:M446_2015"
FT                   /protein_id="ACL55494.1"
FT                   /translation="MSLRVLAALLASLVLSGAALAAEPVYPPGSRFGFEPIQDMQISRR
FT                   FTGFERPGGGATVSVVELPPQDYAALTASFTAESLKAQGLTVKNREELTLGDNRKGILF
FT                   TGEQPIEQPGAPTIAKWVLLIADPTVTGLVIGQTLPGAETDEAMRKMLTSVRVRAALTL
FT                   DQQVAALPFRVTETAGFRPVRVLAGNSVLYTAGPKDQMMNLDQPILVLAEAVQPPLPAE
FT                   QRDAFAKAALYSNQTMKDFAIERSQIFRQGGADWHELVARATDIPSGMPVVVSQTIRFK
FT                   PDGYFRAVGVVKAQDRDSVLPRFRQVVDAVQFP"
     atgtccttgc gcgtcctcgc cgccctgctc gcgagcctcg tcctgtcggg cgcggccctc        60
     gccgccgagc cggtctatcc gcccggctcc cgcttcggct tcgagccgat ccaggacatg       120
     cagatctccc gccgcttcac cgggttcgag cggccgggcg gcggcgcgac ggtctcggtc       180
     gtggagctgc cgccgcagga ttatgccgcg ctcaccgcga gcttcaccgc cgagagcctg       240
     aaggcgcagg ggctcacggt gaagaaccgg gaggagctga ccctcggcga caaccggaag       300
     ggcatcctgt tcaccggcga gcagccgatc gagcagccgg gcgcgccgac aatcgccaaa       360
     tgggtgctgc tcatcgccga cccgaccgtg accggcctcg tcatcggcca gacgctgccg       420
     ggggccgaga ccgacgaggc gatgcgcaag atgctcacca gcgtgcgggt gcgtgcggcg       480
     ctgaccctcg accagcaggt cgccgccctg cccttccggg tcaccgagac ggcgggcttc       540
     cgcccggtcc gggtgctcgc cggcaactcg gtgctctaca ccgccgggcc gaaggaccag       600
     atgatgaatc tcgaccagcc gatcctggtt ctggccgagg cggtgcagcc gccgctgccg       660
     gccgagcagc gggacgcctt cgccaaggcg gccctctact ccaaccagac catgaaggac       720
     ttcgccatcg agcgctcgca gatcttccgg cagggcggcg cggactggca cgaactggtg       780
     gcgcgggcca ccgatatccc ctccggcatg ccggtggtgg tgtcccagac catccgcttc       840
     aagccggacg gctatttccg tgcggtcggc gtcgtaaagg cgcaggaccg cgactcggtg       900
     ctgccccgct tccggcaggt tgtcgacgcc gttcagtttc cctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page